KEGG   Rattus norvegicus (rat): 308468
Entry
308468            CDS       T01003                                 

Gene name
Dyrk1b
Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 1B
  KO
K08825  dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308468 (Dyrk1b)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    308468 (Dyrk1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     308468 (Dyrk1b)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   308468 (Dyrk1b)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    308468 (Dyrk1b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH TCAD9 Choline_kinase
Other DBs
NCBI-GeneID: 308468
NCBI-ProteinID: NP_001100966
RGD: 1307223
Ensembl: ENSRNOG00000019254
UniProt: D4ACC4
Position
1
AA seq 589 aa
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRT
KELRKDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPS
SSTASSISSSGGSSGSSSDNRAYRYSNRYCGGPGPPITDCEMNSPQVLPSQPLRPWAGGD
VPHKTHQAPTSGSTLLGTGAQLPPQPRCLGRPPSPTSPPPPELMDVSLVGSPPDCSPPHP
APAPQHPAASALRTRMTGGRPPLPPPDDPATLGPRLGLHGVPQSTAASS
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggccgtcccaccaggccatggtcccttctctggctttccggggccccaggaacacaca
caggtattgcctgatgtgcggctactgccacggagactgcccctggccttccgggatgcg
acctcggccccgctgcgcaagctctcagtggacctcatcaagacctacaagcacatcaat
gaggtatactatgcgaagaagaagcggcgggcccaacaggcgccaccccaggactcgagc
accaaaaaggagaagaaggtcctgaatcacggctatgacgatgacaaccacgactacatt
gtgcgcagcggcgagcgctggctagagcgctatgaaattgactctcttattggcaaaggc
tcttttggccaggtggtgaaagcctatgatcaccagactcaggagctggtggccatcaag
atcatcaagaacaaaaaggccttcctgaaccaggcacagattgagctgaggctgctggag
ctgatgaatcagcatgatacagagatgaagtactacatagtacacctgaagcggcacttc
atgttccggaatcacctgtgcctggtgtttgagctgctgtcctacaacctgtacgacctc
ctccgcaacacacactttcgcggtgtctcactgaacctgacgaggaagctggcacagcag
ctctgcacagccctgctctttctggccacgcctgagctcagcatcatccactgcgacctc
aagcctgagaacatcctgctctgcaatcctaagcgcagcgccatcaagattgtggacttc
ggcagctcctgccagcttggccagcggatctaccagtatatccagagccgcttctaccgc
tcaccagaggtgctcctgggtacaccctatgacctggccatcgacatgtggtccctgggc
tgcatccttgtggagatgcacaccggagaacccctcttcagtggctctaatgaggtggac
cagatgagccggattgtggaggtgttgggcatccctcccgcacctatgctggaacaggca
cccaaagctcgcaagtactttgagcggctgcctgggggtggctggaccctacgaaggaca
aaggaactcaggaaggacctggtgctgcgcatgctggagtatgagcccgccgcccgcatc
agccctctgggcgctctgcagcatggcttcttccgccgcacggccgacgaggccaccaac
acgggcccggcaggcagcagtgcctccacctcgccggcgccccttgatacctgcccctcc
tctagcaccgccagctccatctccagctctggaggctccagtggctcctccagtgacaac
agggcctaccgctacagcaaccgatattgtgggggcccagggccccccatcactgactgt
gagatgaacagcccccaggtcctaccctcccagcctctgcgcccctgggcagggggtgat
gtgccccacaagacacatcaagcccctacctctggctcaacattgctggggactggggcc
cagttacccccacaaccccgttgccttggacgacccccatcacccacctcaccacccccc
ccagagctgatggatgtgagcctggtgggcagccctccagactgctctccacctcatcca
gcacctgctccccagcacccggctgcctcagccctccggactcggatgacgggaggtcga
ccacctctcccgccccctgatgaccctgccactctggggcctcgtctgggcctccatggt
gtaccccagagcacagcagccagctcatga

DBGET integrated database retrieval system