KEGG   Rattus norvegicus (rat): 308501
Entry
308501            CDS       T01003                                 

Gene name
Cd22
Definition
(RefSeq) CD22 molecule
  KO
K06467  CD22 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04640  Hematopoietic cell lineage
rno04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    308501 (Cd22)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    308501 (Cd22)
   04662 B cell receptor signaling pathway
    308501 (Cd22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    308501 (Cd22)
   04091 Lectins [BR:rno04091]
    308501 (Cd22)
CD molecules [BR:rno04090]
 Proteins
  308501 (Cd22)
Lectins [BR:rno04091]
 I-type lectins (Siglecs)
  308501 (Cd22)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Ig_4 Ig_5 C1-set Ig_6 C2-set_2 Lep_receptor_Ig
Other DBs
NCBI-GeneID: 308501
NCBI-ProteinID: NP_001100973
RGD: 1311610
Ensembl: ENSRNOG00000024000
UniProt: D3ZD88
Position
1q21
AA seq 852 aa
MCVPCPWLLLILGHVASFRSATGWSVEHPQTLFAWEGACIQIPCKYKVPKPRSRLDSILL
FQNYTFDNTTRDFTGKVLYNNTKASIETELYFSQQDRVTFLGNRSNNCTLKIDPIHANDS
GKLGLRLISGTDKWMEHIHLNVSERPFQPYIQLPSEIRESQRVSLTCGLNFTCFGYDISL
RWSLDGSEVSPVTSSITSSVENVYTESKLTFQPKWTDHGKSMMCQVWHFSQVLSERTVRL
DVKYTPKLQITVNPTEVKEGNSVTMTCQVNSSNPSLSTKKVSWFKDGSFLKEQQEQEELT
LHSVTKDMRGKYQCRASNNIGQGQSKEVALTVLYPPEPSKVHIYPSPAEEGQSVELICDS
LASPRATNYTWYHNGEMVPGASHEKLQISNVSLWHAGKYSCLAENRLGCGKIEQEAELDV
HYVPKAVTTVIQSVTPIREGDSVTLDCRYNSSNPEVTKYEWSPQGSGSEVTPGVLRIQKA
TWDSPPIKCAACNYKCSWSFPVSLNVHYAPRAVKILKVSPASEIHAGQHVLLQCDFSGSF
PTEVRFFWKKNGNLVQEGRYLNFSSISPEDSGNYNCMVRNSIGETSSQAWSLQVLYAPRR
LRVSISPGDSVMEGKKATLSCESDAHPPVFKYIWFDANDQDLHFSGQKLRLEPLRVQHTG
SYRCQGINELGTGKSPPSTLTVYYSPETIGKRVALGLGFCLAICILAIWGMKIQKKWKHN
RSQQGPQDNSSGQSFFVRNKKARRTRLTEGPQSQGCYNLAMDDTVSYAVLRFPESDTHGA
GGARSPATQGPPPNDDDTVTYSVLQKRNMGDYENVSPNCPEDESIHYSELVQFGAGKRPQ
AKEDVDYVTLKH
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgtgtgtcccctgcccgtggctcctcctgatccttggacatgtggcttccttccgctca
gcaactggatggtctgttgaacatccccaaaccctctttgcctgggagggagcctgcatc
cagattccttgcaagtacaaagtaccaaagcctaggtcgcgtttggacagcatcctcctt
tttcagaactatacgtttgacaacaccaccagggatttcacaggaaaggtcctctataac
aacacgaaggcgagcatagagactgagctgtacttttctcagcaagacagagtaacattt
ctgggaaacagatcgaacaattgtaccctgaaaatcgacccgatacatgccaatgacagt
gggaagctgggcttgaggttgatctcagggactgacaaatggatggagcacattcacctc
aacgtctctgagagaccgttccaaccttacatccagctgccatcggaaatccgggaatcc
caaagggtttctctgacctgtggactgaatttcacctgctttgggtatgacatcagcctt
cggtggtctctggacgggtccgaggtcagccctgtcacctcttccatcacctcctccgtt
gagaacgtctatacagagagcaagctcaccttccagccaaagtggacagaccacggaaag
agcatgatgtgccaagtctggcacttctcccaagtgctctctgagaggacagtgcgtctg
gatgttaagtacaccccaaaactgcagatcacggtcaatcccacagaggtcaaggagggc
aactctgtgaccatgacatgtcaggttaacagcagcaacccgagtctcagtaccaagaag
gtatcctggttcaaggatgggagcttcctgaaggaacaacaggaacaggaggagctaact
ctgcattcagtgaccaaggacatgagagggaaataccagtgccgggcttccaacaacata
ggccaaggacagtccaaagaagtggcactcacggtgctctatcctccggaaccctccaag
gttcacatctatccctcaccggctgaagagggacagtcagtagagctgatctgcgactca
ctggccagtccaagagcaacaaactacacctggtatcacaatggggaaatggtacccgga
gccagccatgagaagctccagatctctaatgtctccttgtggcatgctgggaaatactct
tgcttggcagagaaccgtctgggttgtggaaagatagaacaggaagctgagctggatgtc
cactatgttcccaaggcggtaaccacagtgattcaaagcgtcacaccaattcgggaagga
gacagcgtgaccctagactgtagatacaactccagcaatccagaggtcaccaagtatgaa
tggagtcctcaaggttctgggagcgaggtcacacctggagtgctaaggattcagaaagcg
acatgggattccccgcccatcaaatgtgctgcctgtaactacaagtgctcgtggtccttc
cctgtcagcctgaatgtccactatgcccccagagccgtgaagatactgaaggtgagcccc
gcatcggagatccacgctgggcagcatgtcctcctccaatgtgacttctcagggagcttc
cccacagaggtccgcttcttctggaagaagaatgggaatctcgtgcaggaagggagatac
ctgaacttcagctccatctctccagaagattctggaaattataactgcatggtcagaaac
tccatcggagagacctcgtcacaggcctggagcctgcaagtgctgtatgctcctcggagg
ctgcgtgtgtccatcagccctggggacagcgtgatggaggggaagaaggccaccttgtcc
tgtgagagtgatgcccacccgcccgtcttcaagtatatctggtttgacgccaatgaccaa
gacctccacttctcgggccagaaactgaggctggaacccctgagagttcaacacacgggt
tcctaccgctgccaagggatcaacgagctaggcacgggaaagtcaccacccagcaccctc
acggtttactacagcccagagaccatcggcaagcgggtcgccttgggactagggttctgc
ctggctatctgcatcctggccatctgggggatgaaaatccagaaaaaatggaagcacaac
cggagccagcaggggcctcaggacaattccagtggccagagcttttttgtgaggaacaaa
aaggctagaaggacccgtctcacagaaggcccccagtcccagggatgctacaatctggcg
atggatgacaccgttagttatgctgtcttgcgctttccagagagtgacacgcacggcgct
ggaggtgcaaggagcccagcaacacagggtcctcctccaaacgacgatgacacagtcact
tactcggtgctacagaagcggaatatgggtgactatgagaatgtgagtccaaactgcccc
gaggatgagagcatccattactcagagctggttcagtttggggctgggaagcggccccag
gcaaaggaagacgtagactatgtgaccctcaagcactga

DBGET integrated database retrieval system