KEGG   Rattus norvegicus (rat): 308571Help
Entry
308571            CDS       T01003                                 

Gene name
Lrrc4b, Lrig4, NGL-3
Definition
(RefSeq) leucine rich repeat containing 4B
  KO
K16360  netrin-G3 ligand
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    308571 (Lrrc4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 I-set Ig_3 LRR_9 ig V-set LRRNT Ig_2 LRR_1 Ig_6 Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 308571
NCBI-ProteinID: NP_001258010
RGD: 1307121
Ensembl: ENSRNOG00000019418
UniProt: P0CC10
Position
1q22
AA seq 709 aa AA seqDB search
MAQAHIQGSPCPLLPPGRMSWPQGALLLLWLFSPPLRAGGGGVAVTSAAGGGSPPATSCP
AACSCSNQASRVICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLS
KNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAF
NRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSG
NRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFT
PLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSH
FTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHD
GTLNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGPGGGGPGGGGGAGGA
GGYTYFTTVTVETLETQPGEEAQQPRGTEKEPPGPTTDGAWGGGRPDAAAPASASTTAPA
PRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLRKQ
HQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVAGGAGVGGDSHLALPALERDHLNH
HHYVAAAFKAHYGGNPGGGCGAKGPGLNSIHEPLLFKSGSKENVQETQI
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggcccacatccaaggctccccgtgccccttgctgccgcctggtaggatgtcc
tggccccaaggggctctcctgctcctgtggctcttctccccacccctgagggccggtggg
ggcggtgtggccgtgacttcagccgccggaggaggctccccgccagccacctcctgccca
gcagcctgctcctgcagcaaccaggccagccgggtgatctgcacgcggagggagctggcc
gaggtgccagccagtatccccgtcaatacccgctacctgaacttgcaagagaacagcatt
caggtgatccgcactgacacattcaagcacctccggcacctggagatcctgcagctgagc
aagaatctggtgcgcaagatcgaagtgggggcgttcaatgggcttcccagtctcaacaca
ctggaactcttcgacaaccggctgaccacagtgcccacacaggcctttgagtacttgtcc
aagctccgggagctgtggctgcgcaacaaccccatcgaaagcatcccatcctatgccttc
aaccgtgtgccctcattgcgccgcctggacctgggcgagctgaagcgtctggagtacata
tcggaggcggccttcgaggggctggtgaacctgcgctacctcaacctgggcatgtgcaac
ctaaaggacatccccaacctcacagcacttgtgcgcctggaagagctggagctgtcgggg
aaccggctggacctaattcgccccggctccttccagggcctcaccagcctgcgcaagctg
tggctgatgcatgcccaagtggccaccatcgagcgaaacgccttcgacgacctcaagtcg
ctggaggagctgaacctgtcccacaacaacctgatgtcgctgccgcacgaccttttcaca
ccccttcaccgcctggagcgtgtccacctgaaccacaacccctggcactgcaactgtgat
gtgctctggctcagctggtggctgaaggagacagtgcccagcaataccacatgctgcgca
cgctgccacgcgcccgccggcctcaagggccgctacatcggtgagctggaccagtcgcac
ttcacctgctatgccccagtcatcgtggagccacccacagacctcaatgtcaccgagggc
atggcggccgagctcaagtgccgcacaggtacatccatgacctcggtcaactggctgaca
cctaacggcacgctcatgacacacggttcctatcgtgtgcgcatttcggtactgcacgat
ggcacactcaatttcactaatgtcaccgtgcaggacacgggccagtacacgtgcatggtg
acaaactctgctggcaacaccactgcctcggccacgcttaacgtgtcggccgtggaccct
gtggctgccggagggcccggtggcgggggcccagggggtgggggcggtgcagggggtgcg
ggcggctacacctacttcaccacggtgactgtggagacgctggagacacagccgggggag
gaggcccagcagccccgaggtactgagaaggagcccccggggcccacgactgatggcgcg
tggggtggcggccggcctgacgctgcagccccggcctcagcgtccaccacggcaccagcc
ccgcgctcctcgcggcccacagagaaggctttcacggtgcccatcacggacgtgacggag
aacgcacttaaggacctagacgatgtcatgaagaccaccaaaatcatcatcggctgcttc
gtggccatcacctttatggccgccgtgatgctggtggccttctacaagctgcgcaagcag
caccagctgcacaagcaccatgggcccacgcgcactgtggagatcatcaacgtggaggac
gagctgcccgccgcctccgctgtgtcggtggctgcggccgctgcggtggctggaggcgcg
ggcgtgggtggggacagccacctggctcttccggcgctggagcgagaccacctcaaccac
caccactacgtggcggctgccttcaaggcgcactacggcggcaatccaggaggcgggtgc
ggggccaagggccccggcctcaactccatccacgaacctctgctcttcaagagcggctcc
aaggagaacgtgcaagagacacaaatctaa

DBGET integrated database retrieval system