KEGG   Rattus norvegicus (rat): 308572Help
Entry
308572            CDS       T01003                                 

Gene name
Myh14
Definition
(RefSeq) myosin heavy chain 14
  KO
K10352  myosin heavy chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    308572 (Myh14)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    308572 (Myh14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    308572 (Myh14)
   04147 Exosome [BR:rno04147]
    308572 (Myh14)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     308572 (Myh14)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   308572 (Myh14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N ADIP IQ AAA_22
Motif
Other DBs
NCBI-GeneID: 308572
NCBI-ProteinID: NP_001094160
RGD: 1306821
Ensembl: ENSRNOG00000020014
UniProt: F1LNF0
Position
1q22
AA seq 2000 aa AA seqDB search
MATVTLSVPGRKVASRPGPVPEAAQPFLFAPRTPNVGGPGGPQVEWTARRMVWVPSELHG
FEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHN
LRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHIYAVTEGAYRS
MLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPASVSTMSYGELER
QLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDIAGYIVGANIETYLLEKSRAIRQAK
DECSFHIFYQLLGGAGEQLKADLLLEPYSHYRFLTNGPSSSPGQERELFQETLESLRVLG
LLPEEITAMLRTVSAVLQFGNIVLKKERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALL
TPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGI
LDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQP
CIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGSHPKFQRPRNLRDQADFSV
LHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDG
PPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQL
RCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPN
LYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQRRQQQQSALRVM
QRNCAAYLKLRNWQWWRLFIKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAREVGELQ
GRVAQLEEERARLAEQLRAEAELCSEAEETRARLAARKQELELVVTELEARVGEEEECSR
QLQSEKKRLQQHIQELETHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSK
ERRLLEERLAEFSSQAAEEEEKVKSLNKLRVKYEATIADMEDRLKKEEKGRQELEKLKRR
LDGESSELQEQMMEQKQRAEELLIQLGRKEEELQSALVRAEEEGGARAQLLKSLREAQAG
LAEAQEDLEAERVARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKREQEVTEL
KKTLEEEARTHEVAMQELRQRHSQALVELTEQLEQARRGKSVWEKTRLSLEAEVSELKTE
LSSLQTSRQEGEQKRRRLESQLQEVQGRSSDSERARAEAAEKLQRAQVELESVSTALSEA
ESKAIRLSKELSSAESQLHDTQELLQEETRAKLALGSRVRALEAEAAGLREQMEEEVVAR
ERAGRELQTTQAQLSEWRRRQEEEAAVLEAGEEARRRAAREAETLAQRLAEKTEAVERLE
RARRRLQQELDDATVDLGQQKQLLSTLEKKQRKFDQLLAEEKAAVLRAVEDRERVEAEGR
EREARALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKNVHELERARRVAEQ
AASDLRTQVTELEDELTAAEDAKLRLEVTVQALKAQHERDLQGRDDAGEERRRQLAKQLR
DAEVERDEERKQRALAMAARKKLELELEELKAQTSAAGQGKEEAVKQLKKMQAQMKELWR
EVEETRSSREEMFTLSRESEKRLKGLEAEVLRLQEELAASDRARRQAQQDRDEMAEEVAS
GNLSKAATLEEKRQLEGRLGQLEEELEEEQNNSELLKDHYRKLVLQVETLTTELSAERSF
SAKAESGRQQLERQIQELRARLGEEDAGARARQKMLIAALESKLAQAEEQLEQESRERIL
SGKLVRRAEKRLKEVVLQVDEERRVADQLRDQLEKSNLRLKQLKRQLEEAEEEASRAQAG
RRRLQRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEEAEG
AEPGSAPTQEPEAPPPAAPQ
NT seq 6003 nt NT seq  +upstreamnt  +downstreamnt
atggccacagtgaccttgtccgtgcctgggaggaaggtggcctccaggccaggcccggtg
cctgaggcagcccagccattcctgttcgcgccccggacgccaaatgtaggtggccctgga
gggccacaggtggagtggacagcacggcgcatggtgtgggtgccctcggaactgcatggg
ttcgaggcagcagccctgcgggatgaaggggaggaggaggcagaagtggagctggcggag
agtgggcggcgcctgcggctgcccagggaccagatccagcgcatgaacccacccaagttc
agcaaggcagaagatatggctgagctcacctgcctcaacgaggcctcggtcctgcacaat
ctgcgagagcgctactactctgggctcatttatacctactctggcctcttctgtgtggtc
attaacccgtacaagcagctgcctatctacacggaggccattgttgaaatgtaccggggc
aagaagcgccacgaggtgccacctcacatctatgccgtgaccgagggcgcgtaccgcagc
atgcttcaggatcgtgaggatcagtccattctctgcacgggagagtctggagctgggaag
acggagaacaccaagaaggtcatccagtacctggcccatgtggcatcatctccaaagggc
aggaaggaacctggtgtccctgcctccgtcagcaccatgtcttatggggagctagagcgg
cagcttcttcaagccaaccccatcctagaagccttcggcaatgccaaaacggtgaagaac
gacaactcttcccgatttggcaaattcatccgcatcaactttgatattgctggctacatc
gtgggagcaaacatcgagacctatctgctggagaagtcccgggccatcagacaggccaag
gacgaatgcagcttccatatcttctaccagctgctagggggcgctggggagcagctaaaa
gctgacctccttctggagccctactcccattaccgcttcctgaccaacgggccctcatca
tcccccggccaggagcgggagttattccaggagaccctggagtccctgcgagtgctgggc
ctcctcccagaagagatcactgccatgctgcgcacagtctcagctgtcctccagtttggc
aacattgtcctgaagaaagagcggaacacggatcaagccaccatgcctgacaacacagct
gcccagaagctttgccgcctcttgggacttggagtgactgacttctccagagcccttctc
acgccccgcatcaaagtcggccgagattacgtccagaaagcacagaccaaagagcaggct
gactttgcgctggaggctctggccaaagctacctatgagcgcctgttccgctggctggtt
ctgcggctcaaccgtgccctggacagaagcccacgtcagggcgcctccttcctgggcatc
ctggacatcgcaggctttgagatcttccagctgaactccttcgagcagctgtgcatcaac
tacaccaatgagaagctgcagcagctgttcaaccacaccatgttcgtgctggagcaggag
gagtaccagcgagaaggcatcccctggaccttcctggactttgggttggacctgcagcct
tgtatcgacctcattgagcggccggccaaccctccaggtctcctggccctgctggacgag
gagtgctggttccccaaggccactgacaagtcttttgtggagaaggttgcccaggagcag
ggcagccaccccaagttccagcgtcctaggaacctacgagatcaagcggacttcagcgtc
ctgcactacgcaggcaaggttgactacaaagccaatgagtggttgatgaagaacatggat
ccattgaatgacaatgtggccgccttgcttcaccagagcacagatcgtctcacagctgag
atctggaaggatgtggagggcatcgtggggctggagcaagtgagcagccttggagatggc
cccccgggaggccgcccccgccgtggaatgttccggaccgtggggcagctctacaaagaa
tccctgagccgcctcatggccacgctcagcaacaccaaccctagttttgtccgctgcatc
gttcccaatcatgagaagagggctgggaaactggagccgcgcctggtgctggaccagctc
cgttgtaatggtgtcctcgagggtatccgcatctgtcgccaaggtttccccaaccgcatc
ctctttcaggagttccggcagcgctatgaaatcctcaccccgaacgccattcccaagggc
ttcatggacggcaaacaggcctgtgagaagatgatccaggccctggagctagaccccaac
ttgtaccgtgttggccaaagcaagatcttcttccgggcaggggtcctagctcaactggag
gaggagcgagatctcaaggtcaccgacatcatagtatcttttcaggcagcggcacggggc
tacctggcccgtagggctttccagaggaggcagcagcagcagagtgctctgagggtgatg
cagagaaactgtgccgcctacctcaagctgaggaactggcagtggtggagactgttcatc
aaggtgaagcccctgctgcaggtgacacggcaggatgaggtgctgcaggcgcgagcccag
gagctacagaaagttcaggagctgcagcagcagagcgcccgtgaagtgggggaactgcag
ggtcgagtggcacagctagaggaggagcgtgcgcgcctggctgagcagctgcgagcggaa
gcggagctgtgctctgaggcggaggagacacgggcacgattggctgcccggaagcaggag
ctggagctggtggtgacagagctggaggcacgagtgggcgaggaagaagagtgcagccgg
cagctacagagcgagaagaagaggctgcagcagcacatccaggagctggagacccaccta
gaagcagaggagggtgcccggcagaaactgcagctggagaaagtgaccacagaggccaag
atgaagaagtttgaggaggatctgctgctcctggaagaccagaattccaagctgagcaag
gagcggaggctgctggaggagcgcctggctgagttctcctcacaggcagcagaagaggaa
gagaaagtcaaaagccttaacaagctgagggtcaaatatgaagccacaatcgcagacatg
gaagaccgactgaagaaagaggagaaaggccgccaggaactagagaagctgaagcgacgg
ctggatggggagagctcagagcttcaggaacagatgatggagcagaagcagagggcagag
gagctgctcatacagctgggccgcaaggaggaagagctgcagtcggccctggtcagggca
gaggaggagggtggtgcccgtgctcagctgctcaagtctctgcgagaggcacaggctggc
cttgctgaggcccaggaggacctggaagctgagcgggtagccagggccaaggcggagaag
cagcgccgggacctgggcgaggagttggaggcgctccgcggggagctagaggacacgctg
gattccaccaacgcccagcaggagctgcggtccaagagggagcaggaggtgacagagctg
aaaaagactttggaagaggaggcccggactcacgaggtggccatgcaggagctgagacag
aggcatagccaggccctggtggagctgacagagcagttggagcaagcacggaggggcaaa
agtgtgtgggagaagacccggctctccctggaggctgaggtgtctgaacttaagacggag
ctgagcagcctgcagacctcaagacaggagggtgagcagaagaggcgacgcctggagtcc
cagctacaggaggtccagggccgatccagcgattccgagagggctcgggctgaggctgct
gagaagctacagagagcccaggtggaacttgagagcgtgtccacagccctaagtgaggct
gagtccaaggccatcaggctgagcaaggagctgagcagtgcagagtcccagctgcacgac
acccaggaactgctgcaggaggagaccagggcaaagctggctttggggtcccgtgtgcgt
gccctggaggccgaggcagccgggcttcgggagcagatggaagaggaggtggttgccagg
gaacgggctggccgagagctgcagaccacacaggcccagctctctgaatggcggcgacgc
caggaagaagaggctgccgtgctggaggctggggaggaggctcggcgccgtgcagcccgg
gaggcagagaccctggcccagcgcctggcagaaaagactgaggctgtagaaagactggag
cgagcccggcggcggctgcagcaggagctggacgacgccactgtggacctggggcagcag
aaacagctcctgagcacactggagaagaagcagcgaaagtttgaccagctcctggcagag
gagaaggctgcagtgctacgggctgtggaagatcgtgaacgggtagaggctgaaggccgg
gagcgagaggcccgggccctgtcgctgacacgggccctggaagaggagcaggaggcacgg
gaggagctggagaggcagaaccgtgctctgcgggctgagctggaggcactgctaagcagc
aaggatgatgttggcaagaatgtgcacgagctcgagcgagcccgcagggtggctgaacag
gcagccagtgacctgcggacacaggtgacagaactggaggatgagctgactgccgcggag
gatgccaaactgcgcctggaggtgactgtgcaggccctgaaggctcaacatgaacgcgac
ctgcagggccgtgatgatgctggcgaggagaggcggaggcagctggccaagcagctgaga
gacgcagaggtagagcgcgatgaggaacggaagcagagggcactggccatggctgcccgc
aagaagctggagttggaactggaggagttgaaggcacagacatctgctgctgggcagggc
aaggaagaggcagtgaagcagctgaagaagatgcaggcccagatgaaggagctgtggcgg
gaggtggaggagacgcgtagctcccgcgaggagatgtttaccctgagcagggaaagtgag
aagaggctcaaggggttggaagctgaggtgctgcggctgcaggaggaactggctgcctca
gaccgagcccggaggcaggcacagcaggacagagatgagatggcagaggaggtggccagt
ggcaaccttagcaaggcagccaccctggaggagaaacggcagctggaggggcgactgggc
cagttggaagaggagctggaggaagagcagaataactcggagctgctcaaggaccactac
cgaaagctggtgctacaggtagagaccctcaccacagagctgtctgctgaacgcagtttc
tcagccaaggctgagagtggaaggcagcagctggagcggcagatccaggaactgcgggcc
cgcctgggtgaagaggatgctggagccagagccaggcagaaaatgctgatcgccgctctt
gagtctaaactggcccaggcagaggagcagctggagcaggagagcagagagcgcatcctc
tctggcaagctggtacgcagagccgagaagcggctgaaggaggtggttcttcaggtggat
gaagagcgcagggtggctgaccagctccgggaccagctggagaaaagcaacctccggctg
aagcagctcaagagacagctggaggaggcagaggaggaagcatctcgggcacaggctggc
cggaggcgtctgcagcgggagctggaggacgtcactgagtctgcagaatccatgaaccgg
gaggtgaccacgctgaggaacaggctccggcgtggcccgcttactttcaccacgcgaact
gtgcgccaggtgttccggctggaagagggcgtggcttccgacgaggaagaggctgagggg
gcagagcctggttctgcaccaacccaggagcctgaggctccgccccctgccgctccccag
tga

DBGET integrated database retrieval system