KEGG   Rattus norvegicus (rat): 308577
Entry
308577            CDS       T01003                                 

Gene name
Fuz, RGD1310608
Definition
(RefSeq) fuzzy planar cell polarity protein
  KO
K22861  protein fuzzy
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    308577 (Fuz)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   CPLANE complex
    308577 (Fuz)
SSDB
Motif
Pfam: Fuz_longin_1 Fuz_longin_3
Other DBs
NCBI-GeneID: 308577
NCBI-ProteinID: NP_001032735
RGD: 1310608
Ensembl: ENSRNOG00000053084
UniProt: Q3B756
Position
1q22
AA seq 349 aa
MGDDGPGSTVHLLCLAASSGVPLFCRSSSGGAPSRQQLPFSVIGSLNGVHMFGQNLDVQL
NSARTEDTTVVWKNFHDSITLIALSSEEGTSELKLERMLHMVFGAMVLIVGLEELTNIRN
VERLKKELRASYCLIDSFLGNSELIGDLTQCVDCVIPPEGSVMQVPHRLLTLTLLRGLEL
CLLCGPRPPLGELDPQLLERWWQPLLEPLRACLPLGPRALPDGFPLHSDILGLLLLHLEL
RRCLFTVEPSKDKEPSPEQRRRLLRNFYTLVATTHFPPEPGPAEKQEDTVHPAQTPRACY
LVLGPGMGWQLVAVQLGLRLLLLMLSPQTPTHGLRSLATHTLQALTPLL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgggggatgacgggccaggaagcacggtgcatctgctgtgcctcgcagcctctagcggg
gttcccctgttctgtcggagcagcagcggaggcgccccctcccgtcaacagctccctttt
tctgtcatcgggtccctcaatggagtccacatgttcggccagaatctggatgtgcaactg
aactccgcaagaacagaagacaccaccgtagtgtggaagaacttccatgacagcatcacc
ctcattgctctgtcatctgaggagggcacctctgagctgaagctggaaagaatgctccac
atggtgtttggggccatggttctcattgtgggacttgaggagctgaccaatatccggaat
gtagagagactgaagaaagagctgagggccagctactgtctcattgacagcttcctgggg
aattcagagctcatcggggacctgacccagtgtgtggactgtgtcattcctccagagggg
tctgtcatgcaggtcccccatcggttgttgaccttgactctgctgcggggcctggagctg
tgtctgctctgcgggccgcgcccgcccctcggtgagctggacccacagttgctggaacgc
tggtggcagcctctgctggagcccctccgggcttgcctgccactgggccctagggcgctc
cctgacgggttcccgctacacagcgatattcttggcctgttgttactccacttggaactg
agacgctgcctctttaccgtggagccctcaaaggataaagagccttcccctgagcaacgc
aggcgcctccttagaaatttctatacgttggtggccaccacccacttcccaccagaaccg
gggccagcagagaaacaagaagatacagtccacccagcccagacacccagggcctgctat
cttgtgctagggccaggcatggggtggcagctggtggctgtgcagctagggctacggctg
ctgctgttgatgctgtccccgcagactcccacccatgggctgagaagcctggccacccac
actctacaagccctcaccccgctcctttga

DBGET integrated database retrieval system