KEGG   Rattus norvegicus (rat): 308578Help
Entry
308578            CDS       T01003                                 

Gene name
Ap2a1
Definition
(RefSeq) adaptor-related protein complex 2, alpha 1 subunit
  KO
K11824  AP-2 complex subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    308578 (Ap2a1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    308578 (Ap2a1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    308578 (Ap2a1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    308578 (Ap2a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    308578 (Ap2a1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    308578 (Ap2a1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    308578 (Ap2a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   308578 (Ap2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1 Dymeclin
Motif
Other DBs
NCBI-GeneID: 308578
NCBI-ProteinID: NP_001100981
RGD: 1306254
Ensembl: ENSRNOG00000026243
UniProt: D3ZUY8
Position
1q22
AA seq 977 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAASALDDSRRDTSSNDINGGVEPTPSNVSTPSPSADL
LGLRAAPPPAAPPAPVGGNLLVDVFSDGPTAQPSLGPTPEEAFLSELEPPAPESPMTLLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNSGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQSFLPTVVHPGDLQTHLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGTAQSLTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPLQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggctgtatccaaaggcgatggcatgcgtgggcttgccgtgttcatctccgacatc
cggaactgcaagagcaaagaggctgagatcaagaggatcaacaaggaactggccaacatc
cgctccaagttcaaaggggacaaggccttggatggctacagtaaaaagaagtatgtgtgt
aagctgctcttcatcttcctgcttggccatgacattgactttggacacatggaggctgtg
aacctgctaagctccaacaagtacacagagaagcagatagggtacctgttcatctcagtc
ctggtgaactcgaactcagagctgatccggctcattaacaacgctatcaagaacgacctg
gccagtcgcaaccccaccttcatgtgcctggctttgcactgtattgccaacgtgggcagc
cgtgagatgggcgaggcctttgctgccgacattccccgaatcctggtggccggagacagc
atggatagtgtgaagcagagtgcagccctatgcctactgcgtctctacaaggcctccccc
gacttggtgcccatgggcgagtggacggcccgggtggtgcatttgctcaatgatcagcac
atgggagtggtcacagccgctgtcagtctcatcacctgcctgtgcaagaagaatccagat
gacttcaagacctgtgtctccctggctgtgtctcgcctaagccggattgtctcctcagcc
tccactgacctccaggactacacttactacttcgttcctgcaccctggctctctgtgaag
ttactgcggttgctacagtgttacccaccgccagaggatgcggctgtgaaagggcggtta
gtggagtgtcttgagactgtgctcaacaaggcccaggagcctcccaagtccaagaaggtg
cagcactccaatgccaagaacgccatcctgtttgagactattagcctcatcatccactat
gacagtgagcccaacctcctggtccgtgcctgcaaccagctgggccagttcctgcagcac
cgagagacgaacctgcgctacctggctctggagagcatgtgcaccctggccagctccgag
ttctcccacgaggctgtcaagacccacattgatactgttattaatgccctcaagactgag
cgggacgtgagtgtgaggcagcgggcagctgatctgctgtatgccatgtgtgaccggagc
aatgccaagcagattgtatcagagatgctgcggtacctagagacggctgactatgccatc
cgagaggagattgtgctgaaggtggccatcttggctgagaagtatgcagtggactacagc
tggtatgtggacaccatcctcaacctcatccgcattgcaggcgactatgtgagcgaggag
gtgtggtaccgagtgctgcagatcgtcaccaaccgtgatgatgtccagggttatgctgcc
aagacagtgtttgaggccctccaggccccagcctgtcatgagaacatggtgaaggtcggt
ggctacatccttggggagtttgggaacttgattgctggggacccacgctccagcccacct
gtgcagttctcactgctgcactccaagttccacctgtgcagtgtggccactcgtgccttg
ctgctgtccacctacatcaagttcatcaacctcttccctgagaccaaggccaccatccaa
ggtgttcttcgtgccggctcccagctgcgcaatgctgacgtggagctacagcagcgggca
gtggagtacctcaccctcagctctgtagctagcaccgatgttttggctactgtgctagaa
gaaatgcccccatttcctgagcgggagtcatccattttggctaagctgaagcgtaagaag
ggccctggggcagccagtgccctggatgacagccgcagggacaccagcagcaatgacatc
aatgggggtgtggagcccacccccagcaatgtgtcaaccccctcaccctccgcggacctc
ttggggctgcgggcagcccctccccctgctgcacccccagctcctgtaggcgggaacctc
ctggtggatgttttctctgacggccccactgcacagcccagcctgggtcccacccctgag
gaggccttcctcagcgagctggagccccctgcccctgagagccccatgactttgttggct
gacccagctccagctgctgacccaggtcctgaggacataggtcctcccattccagaagca
gatgaactgctgaataagttcgtgtgtaagaatagtggggtcttgtttgagaaccagctg
ctgcagatcggagtcaagtctgagttccggcagaacctgggccgcatgtatctcttctat
ggcaacaagacttctgtgcagttccagagcttcttgcccaccgtggtccaccctggggac
ctccagactcatctggcggtgcagaccaagcgtgtagctgcacaagtggacggtggcgca
caggtgcagcaagtactcaacattgagtgtctgcgagacttcttgacgccaccactgctg
tcggtgcgcttccggtacggtggcaccgcccagtccctcactctgaagctcccagtgacc
atcaacaaattcttccagcccacagagatggccgcccaggactttttccagcgctggaag
cagctgagcctccccctgcaggaggcacagaaaatcttcaaagccaaccaccccatggat
gctgaagtcacaaaggccaagcttctggggtttggctctgctcttctggacaatgtggat
cccaaccctgagaactttgtgggtgctggaatcatccagacgaaagccctgcaggtgggg
tgtctgcttcgactggagcccaatgcccaggcccaaatgtaccgcctaaccctgcgcacc
agcaaagagcctgtgtcccgtcacttatgtgagctgctggcccagcagttctga

DBGET integrated database retrieval system