KEGG   Rattus norvegicus (rat): 308588Help
Entry
308588            CDS       T01003                                 

Gene name
Car11, CAR-XI
Definition
(RefSeq) carbonic anhydrase 11
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 308588
NCBI-ProteinID: NP_783639
RGD: 735155
Ensembl: ENSRNOG00000021017
UniProt: Q811X3
Position
1q22
AA seq 328 aa AA seqDB search
MGGAARLSAPQALVLWAALGAAAHIGPAPDPEDWWSYKENLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPASRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAASRGPNG
LAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGS
LSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR
GNRDPRHPERRCRGPNYRLHVDGGPHGR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggggggtgcggctcgcctgagcgcccctcaagcgctggtactctgggccgcactggga
gcggcagctcacatcggacccgcacctgatcccgaggactggtggagctacaaggagaat
ctccagggaaacttcgtgccagggcctcccttctggggcctggtgaacgctgcctggagt
ctgtgcgctgtggggaagcggcagagccctgtggatgtggagctgaagcgggttctttat
gacccttttctgcccccgctcaggctcagcaccgggggagagaagctccggggaacctta
tacaacactggccgccatgtctccttcctacctgcatcccggcctgtggtcaacgtgtct
gggggtccccttctctatagccaccgactcagtgaactgcggctgctgtttggagctcga
gatggtgctggctccgaacaccagatcaaccatcaaggcttctctgctgaggtgcagcta
atccacttcaaccaagaactctatgggaatctcagtgctgcctcaaggggccccaatggc
ctggccattctcagcctctttgtcaacgtggctggcagctccaacccgttccttagtcgc
ctcctcaaccgggacactattacccgaatctcctacaaaaatgatgcctactttcttcaa
gacctgagcctggagctcctgttcccggaatcctttggcttcatcacctatcagggatct
ctcagcactcctccctgctctgagactgtcacctggatcctcatcgacagggctctcaat
attacctccctccagatgcactccctgagactcctgagccagaatcccccctcccagatc
ttccagagcctcagtggtaatggccggcccttgcagcccctggcccacagagccttgagg
ggcaacagggacccccggcaccccgagaggcgctgccgaggccccaactaccgcctgcat
gtggatggtggtcctcatggtcgctga

DBGET integrated database retrieval system