KEGG   Rattus norvegicus (rat): 308592Help
Entry
308592            CDS       T01003                                 

Gene name
Grwd1
Definition
(RefSeq) glutamate-rich WD repeat containing 1
  KO
K14848  ribosome assembly protein RRB1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    308592 (Grwd1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    308592 (Grwd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 CAF1C_H4-bd ANAPC4_WD40 Voldacs
Motif
Other DBs
NCBI-GeneID: 308592
NCBI-ProteinID: NP_001012067
RGD: 1310649
Ensembl: ENSRNOG00000021058
UniProt: Q5XI13
Position
1q22
AA seq 445 aa AA seqDB search
MAARKGRRHTCETGEPMEAETYDLGSEGPSQVYLPGRGPPLGEGEELVMDEEAYVLYHRA
QTGAPCLSFDIVRDHLGDNRTELPLSLYLCAGTQAESAQSNRLMMLRMHNLHGTRPPPSE
GSDDEDDEDEEDEEERKPQLELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFALR
RLLQVVDDPQALAIFLRDEQARVKPIFSFAGHMGEGFALDWSPRVPGRLLTGDCQKNIHL
WTPTDGGSWNVDQRPFVGHTRSVEDLQWSPTEDTVFASCSADASIRIWDIRAAPGKACML
TTAAAHDGDVNVISWSRREPFLLSGGDDGTLKVWDLRQFKSGSPVATFKQHVAPVTSVEW
HPQDSGVFAASGADNQITQWDLAVERDPESGETETDPGLAALPQQLLFVHQGETDLKELH
WHPQCPGVLISTALSGFTVFRTISV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgcaagggccggaggcacacatgtgaaaccggggagcccatggaggctgaa
acctacgatctaggatccgaaggcccatcccaggtctacctgcccggcagagggccgcca
ctaggagaaggggaggagctggtaatggatgaagaggcctacgtgctataccatcgtgcg
caaactggcgccccttgtctcagctttgacatagtccgagatcacctgggcgacaaccgg
acagagctccctctcagtctttacctgtgtgcgggaacccaggcggagagcgcccagagc
aatagactgatgatgcttcggatgcacaatctccatgggaccaggccgccaccctcagag
ggcagtgatgatgaggatgatgaagatgaagaggatgaagaggagcggaaacctcaactg
gagctggccatggttccccactatggtggcatcaaccgagttcgggtatcttggctggga
gaggagcccgtggctggagtatggtcagagaagggccaggtggaggtgtttgcactgcga
cggctcctgcaggtggtggatgacccgcaggccctggccatcttcctccgcgatgagcag
gcccgagtaaagcccatcttctcctttgctggccacatgggtgagggctttgctcttgac
tggtcccctcgggtacccggccgcttgttgactggtgactgtcagaagaacatccatctc
tggacacccacggatggtggttcctggaatgtggaccagaggccatttgtgggccataca
cgctctgtggaggatctgcagtggtcgccaacagaggacacggtgtttgcctcgtgctct
gcggatgcctccattcgcatctgggacatccgagcagccccaggcaaggcctgcatgctc
accacagccgctgcccatgatggggatgtcaacgtcatcagttggagccgcagggaaccc
ttcctgctcagtggtggggatgatgggaccctcaaagtctgggacctgcgacagttcaag
tctggctcccctgtggccaccttcaagcaacacgtggcccccgtgacctccgttgaatgg
caccctcaggacagtggggtctttgcagcctcaggtgctgacaaccagatcacacagtgg
gacctggcagttgagcgggacccagagtcaggtgagacagagacagaccctgggctggcg
gcactgccccagcagttgctgttcgtgcatcaaggtgagactgacctgaaggagctacac
tggcacccacagtgccctggggtcctgatcagcaccgccctgtcaggcttcaccgtcttc
aggaccatcagtgtttga

DBGET integrated database retrieval system