KEGG   Rattus norvegicus (rat): 308598
Entry
308598            CDS       T01003                                 

Gene name
Hps5, Aa2-028, Ab1-018
Definition
(RefSeq) Hermansky-Pudlak syndrome 5
  KO
K20191  Hermansky-Pudlak syndrome 5 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    308598 (Hps5)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   BLOC-2 complex
    308598 (Hps5)
SSDB
Motif
Pfam: Ge1_WD40
Other DBs
NCBI-GeneID: 308598
NCBI-ProteinID: NP_001129084
RGD: 1311916
Ensembl: ENSRNOG00000055531
UniProt: F1LS35
Position
1q22
AA seq 1126 aa
MTSVPVIPEAYSHVLAEFESLDPLLTALRLDSSRLKCSSIAVSRKWLALGSTGGGLNLIQ
KDGWKQRLFLSHREGAISQIACCSHDDDYVAVATSQGLVVVWELNQERRGKPERIHVSSE
HKGRKVTALCWDTAVLRVFVGDHVGKVSAIKLNTLKQAKAAAAFVMFPVQTIITVDSCVV
QLDYLDGRLLVSSLTRTFLCDTEREKFWKIGNKEREGEFGACFFPGRCAGSQQPLIYCAR
PGSRIWEVSFDGEVLSTHQFKKLLSMPPLPVITASSEPQYDHAVGSSQSLSFPKLLHFSE
HCVLTWTEKGIYIFIPQNVQVLLWSEVKDIQDVAVYKNELFCLHFNGKISHLSLLSVERC
VERLLRRGLWDLAARTCCLFQNSIITSRGRKTLSTDKLEHLKSQLDLTACSELISQLEEV
IFKFEPLDSACSSRRSSISSHESFSILDSGIYRIISSRRGSQSDEDSCSLHSQTFSEDER
LKEFASHQEEEQPEQGCCANRNGDSVSHSPMMSEIDKGEAFLPFNIPLPFRSPSPLLSLQ
AVKDSVSSFVRKTTEKIGTLHASPELKETSEPRDADQVHEEEVSAVTCPLEEDTEEKEIH
QPPEEDRLQGLRAATAEAVTKLLDPLVLFEPKLLRAVLHEWLSQLEKTFAMKGFAAISNT
SSLPEKSNLDTHLLGESEKRVLCEESGEERRVTLGTEEPGGQTTCDSVSSLSEPSADSFQ
VCPPYAIANSLQKDLVELTTLCLELNVLTSAVESDSRHMDCALQQLSPETLACRFLKKYF
FLLDLKRAKESVKLSHYSPCVWDTFVEGLKEMASSTPAYMEMGERDLPTGLQLLDGSVPS
HSPLLIAFAARLYDRFGEPALRALIKFYPSISPSDIAQLCRRHPAQFLAYLDSLVKSRPE
DQWPSFLEFLLQPESLRLEWLLLAVSHDAPPSTSTVDDEGHPRPHSHLLSWGYSQLILLL
IKLPADFATKEKMTDICRSYGFWPGYLTLCLELERRREAFTNIVYLNDVSLMEGDNGWIP
ETLEEWKLLLHLLQNKNTRPAPQESLNGSLSDGPTPINVENVALLLAKAMGPDRAWSLLQ
ECGLALELSEKFTRTCDILRIAERRQRALIQGMLEKCDRFLWSQQA
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgacttctgtgcccgtgataccagaagcctacagccatgttcttgcagagtttgagtcc
ttggacccgttactcacagccctgcggctggactccagtcgtctgaagtgttccagcata
gctgtgtctcggaaatggctggccttaggcagcacaggaggaggactcaatctcattcag
aaagatggctggaagcaaaggctgtttctctcccaccgggaaggggcaatctctcagatt
gcctgctgctctcatgatgatgattatgttgccgtggctaccagtcaaggtcttgtagtt
gtttgggaattaaatcaagagcgtcgtgggaaaccagagcgaatccatgtgtcctcagaa
cacaaaggccgaaaagttaccgccctttgttgggacacagctgtcctgagagtctttgta
ggtgaccacgtgggcaaagtttctgccatcaaactcaatactttgaaacaagcaaaggca
gctgcggcctttgtgatgtttcctgtccagacaataataacagtcgactcctgtgtcgtc
cagttagattatttggatggaagattacttgtgtcttcactgactcgaaccttcttgtgc
gacactgagagggaaaagttttggaagattggaaataaggaaagagaaggagagtttggg
gcgtgtttcttccctggaaggtgtgctgggagccagcagcctctgatctactgtgcccgc
ccaggctccaggatatgggaagtgagctttgatggggaagtgctcagtacacaccagttc
aagaagctcctctcaatgccgccccttcctgtcatcactgcaagctcggagcctcagtat
gatcacgcagttgggtcctcccagtctttatcgttccccaaactcttgcattttagtgaa
cactgtgtgctgacttggacagaaaagggaatttatattttcattcctcagaatgttcaa
gttcttctttggagtgaagtcaaggatattcaggatgtagctgtctacaagaatgaattg
ttctgtttgcactttaatgggaaaatctcacatctttccctgttgtctgtggaacgctgt
gtagaacgcctgttaaggagaggcctgtgggacctggctgctcgcacatgctgtctcttc
caaaactctattattaccagcagaggaagaaaaacactgtctacagataaattggagcat
ttgaaatctcagctggaccttacagcctgcagtgaactaatttctcagctggaagaagtg
atcttcaagtttgagcctttggattcagcttgcagcagcagaagaagctccatttcgtca
catgaaagttttagcatcttggactctggtatttatcgtatcatcagtagtagaagaggc
agtcagtccgacgaagattcttgctcccttcacagccagaccttctcagaagacgagaga
cttaaagaatttgcatcacaccaggaagaggagcagccagagcagggctgttgtgcaaac
agaaatggagacagtgtttcccacagtccaatgatgtctgagatagataagggggaagcg
tttctgcccttcaacattccactgccatttcgttctccttctcccctcctgtctcttcag
gctgttaaggacagtgtttctagctttgtgcgtaagactactgagaagattggcaccctt
catgcaagcccagagctgaaagagacatcggaacccagggatgctgaccaagttcatgaa
gaggaagtgagtgccgtcacctgccctctggaggaggacactgaggagaaagaaatccat
caacctcctgaagaagacaggcttcagggactcagagcagcgacagcagaagcagtgacc
aagttactggaccccctggttttgtttgaacccaagttgctaagagcggttttacacgag
tggctttcacagttagaaaaaacatttgccatgaaaggctttgctgccatttccaacacc
agcagtctacccgagaaatcgaacctggatacgcacctcctcggtgagtcagaaaaaaga
gtattatgtgaagagagtggagaagaaagaagggtcaccttaggcactgaagaacctggc
ggtcagacaacctgtgactctgtaagcagcctgagtgagccctcggccgacagttttcaa
gtctgtcctccttacgccatagcaaacagccttcagaaggacctggtggaattgacaacg
ttgtgcttggaactgaacgtgttgacctctgcggtggaaagcgatagtagacacatggac
tgtgctttgcagcagctctctccagagaccctggcttgtcgtttcctgaagaagtacttt
tttctcctggacttgaaaagggcaaaggagagtgtcaagcttagtcactacagcccctgt
gtttgggacacttttgttgaaggactaaaagaaatggcaagttctactcctgcctacatg
gagatgggagaaagagacctgcccaccgggttacagttgctggatggctccgtcccttcc
catagtcccctgctgattgcctttgccgcccggctgtatgacagatttggggagcctgcc
cttcgagccttgatcaagttttacccgtccatctcaccttccgacattgcgcagctttgc
cgtcgtcatccggctcagtttttggcctatctggacagtctggtgaagtccaggcccgag
gaccagtggccatccttccttgagttccttctacaaccagaatctttaagacttgaatgg
ctgcttttggcagtgtcccatgatgctccaccaagcacaagtacagtggatgatgaagga
catcccaggccccattcacacctgctttcttggggttatagccagctgattcttcttctg
attaaacttcctgcagactttgcaaccaaagagaaaatgactgacatctgtaggtcttat
ggtttctggcctggatatcttaccctctgtctggagctggagaggaggagggaggccttc
accaacattgtgtatctgaatgatgtcagcctgatggaaggggacaatgggtggatccct
gagaccttggaggaatggaagcttctcctacatctactacagaacaagaacacaaggcca
gctcctcaggagtcactaaatgggagcctcagtgatgggcctacccccatcaatgtggag
aatgtggcactcctgttagctaaggccatgggcccagatagggcctggtcactgctacag
gagtgcggtctggcccttgagttgtcagaaaagtttaccagaacctgtgacatcctgagg
attgctgagagaaggcagagagcgctgatacaaggcatgcttgagaagtgcgaccggttc
ctctggtcacagcaggcctag

DBGET integrated database retrieval system