KEGG   Rattus norvegicus (rat): 308718Help
Entry
308718            CDS       T01003                                 

Gene name
Pex7
Definition
(RefSeq) peroxisomal biogenesis factor 7
  KO
K13341  peroxin-7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    308718 (Pex7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 eIF2A Rav1p_C WH1
Motif
Other DBs
NCBI-GeneID: 308718
NCBI-ProteinID: NP_001029319
RGD: 1308483
Ensembl: ENSRNOG00000012322
UniProt: Q498S5
Position
1p12
AA seq 318 aa AA seqDB search
MSAARTLRVPGRHGYAVEFSPYLPGRLACAAAQHYGIAGCGTLLVLDQNESGLQIFRSFD
WNDGLFDVTWSENNEHVLVTCSGDGSLQLWDTAKATGPLQVYKEHTQEVYSVDWSQTRDE
QLVVSGSWDQTVKVWDPTVGNSLCTFRGHESVIYSTIWSPHIPGCFASASGDQTLRIWDV
KTTGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAI
RRVKFSPFHASVLASCSYDFTVRFWNFSKPDPLLETVEHHTEFTCGLDLSLQSPTEVADC
SWDETVKIYNPVCLAVPG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcgcggacgctgcgggtgccgggtcgccacggctatgcggtcgagttctct
ccgtacctgccgggccgcctggcctgtgccgctgcgcagcattacggcatcgcgggctgt
ggaaccctattggtattggatcaaaatgaatctggactccagatttttagaagctttgac
tggaacgacggcttatttgacgttacctggagtgaaaacaatgaacacgtccttgtcacc
tgtagcggtgacggctcactgcagctctgggacactgccaaagccacagggcctctccag
gtctataaagagcacactcaggaggtgtacagtgttgattggagccaaaccagagatgaa
caacttgtagtgtctggctcctgggaccaaactgtcaaagtgtgggatccaactgttgga
aattctctgtgtacctttagaggccacgagagtgtcatttacagcacaatctggtctccc
cacatccctggttgttttgcttcagcctcaggtgatcagactctgagaatctgggatgtg
aagaccacaggagtccgaattgtgattccagcacatcaggccgaaatcctgagctgtgac
tggtgtaaatacaatgagaacttgctggtgacaggtgcggtagactgtagcctgagaggc
tgggacttaaggaatgtgcgacagcctgtgtttgaacttcttggtcacacgtacgccatt
aggagggtgaaattctcaccatttcatgcctccgtgttggcctcttgttcctatgatttc
actgtaagattctggaatttttcaaagcctgatccacttctggaaacagtggagcatcac
acagagttcacctgtggcttagacctaagtctccagagccccactgaggtagctgactgc
tcctgggatgaaaccgtaaagatctacaaccctgtctgtctcgcagttcccggttaa

DBGET integrated database retrieval system