KEGG   Rattus norvegicus (rat): 308739
Entry
308739            CDS       T01003                                 

Gene name
Rgma
Definition
(RefSeq) repulsive guidance molecule A
  KO
K23096  repulsive guidance molecule A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    308739 (Rgma)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    308739 (Rgma)
SSDB
Motif
Pfam: RGM_N RGM_C
Other DBs
NCBI-GeneID: 308739
NCBI-ProteinID: NP_001100994
RGD: 1311983
Ensembl: ENSRNOG00000012874
Vega: OTTRNOG00000000628
UniProt: D4A188
Position
1
AA seq 449 aa
MQPPRERLVVTGRAGWMGMGRGAGRSALGLWPTLAFLLCSFPAAISPCKILKCNSEFWSA
TSSGSHAPASDDVPEFCAALRTYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDG
PTSQPRVRTLPPAGDSQERSDSPEICHYEKSFHKHSAAPNYTHCGLFGDPHLRTFTDHFQ
TCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDEL
PSAFADGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEE
VVNAVEDRDSQGLYLCLRGCPLNQQIDFQAFRANAESPRRPAAASPSPVVPETFPYETAV
AKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDGKMLHSNKDKLHLFERTRELP
GAVAAAAFPLAPEMLPGTVTLLVLLPLFW
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcagccgccaagggagaggctagtggtaacaggccgagctggatggatgggtatgggg
agaggggcaggacgttcagccctgggattgtggccgaccctcgccttccttctctgcagc
tttcccgcagctatctctccctgcaagatcctcaagtgcaactctgagttctggagcgcc
acgtcgtcaggcagccacgcccctgcctctgacgacgtgcccgagttctgtgctgccctg
cgcacctacgccctgtgcacgcgacggacagcccgcacctgccggggcgacctggcttac
cactcggctgtccatggcatagaggacctcatgagccagcacaactgctccaaggatggc
cccacctcacagcctcgagtgcgcacgctcccgccagctggggacagccaggagcgctca
gatagccccgagatctgccactatgagaagagtttccacaagcactcagctgcccccaac
tacactcactgcggcctctttggggacccacacctcaggactttcacagaccacttccag
acatgtaaggtgcaaggcgcttggcctctcatcgacaataattacctgaacgtgcaggtc
accaatacacctgtgctgcccggctctgccgccactgccaccagcaagctcaccatcatc
ttcaagaacttccaagagtgtgtggaccagaaagtataccaagccgagatggacgagctt
ccgtccgcctttgccgatggctccaaaaacggtggagataaacacggagccaacagcctg
aagatcacagagaaggtgtcaggccagcacgtggagatccaggccaagtacatcggcacc
accatcgtggtgagacaggtgggccgctacctgaccttcgccgtccggatgcccgaggag
gtagtcaacgccgtggaggaccgtgacagccaaggcctctacctctgcctgcggggctgc
ccgctcaaccagcagatcgacttccaggctttccgtgccaacgccgagagccctcgcagg
ccagcagctgccagcccctctcctgtggtccccgagacatttccgtacgagacagctgtg
gccaagtgcaaagagaagctgcctgtagaagacttgtactaccaggcctgtgtcttcgac
ctcctcacgactggcgacgtgaacttcacgctggccgcctactatgctttggaggatggc
aagatgctccactccaacaaggacaagctacacctgtttgaaaggactcgggagctgcct
ggcgctgtggccgctgcagcatttcccttggcccccgagatgctcccgggcaccgtcaca
cttctggtcctgctgcctctgttctggtag

KEGG   Rattus norvegicus (rat): 681433
Entry
681433            CDS       T01003                                 

Gene name
Rgmb
Definition
(RefSeq) RGM domain family member B isoform X1
  KO
K06847  RGM domain family member B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    681433 (Rgmb)
SSDB
Motif
Pfam: RGM_C RGM_N
Other DBs
NCBI-GeneID: 681433
NCBI-ProteinID: XP_006228044
RGD: 1595392
Ensembl: ENSRNOG00000048190
Position
1
AA seq 477 aa
MMRKRKKRGVRPGPCRSPRPGPATAPAPPPSQERTRPAWTGMGVRAAPSCAAAPAAAGAE
QYHRPGLWPPSPPPPLLLLLLLSLGLLHAGDCQQPAQCRIQKCTTDFVSLTSHLNSAADG
FDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTH
DPCNYHSHGGVREHRGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLS
VQVTNVPVVPGSSATATNKITIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVK
SLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGC
PMSECIDDGQGQVSAILGHSLPHTTSAQAWPGYTLETASTQCQEKMPVKDIYFQSCVFDL
LTTGDANFTAAAHSALEDVAALHPRKERWHIFPSSHGGHSDLPVGLGLTCLILTMVL
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgatgaggaagaggaagaagagaggcgtgcgccctggcccatgccgcagcccgaggccc
ggcccagccactgcgcccgcgccgccgccctcgcaggagcgcacgagacctgcatggacg
ggcatgggcgtgagagcagcaccttcctgcgccgccgcccccgccgccgccggggctgag
cagtaccaccgccccggactctggccgccgtcgcccccgccgccgctgttgctgctgctg
ctgctcagccttggactgctccacgcaggtgattgccaacagcctgctcaatgtcgaatc
cagaaatgtaccacagacttcgtgtccctgacttcacacctgaactccgcggccgatggc
tttgactctgagttttgcaaggcacttcgtgcctatgctgggtgcacccagcgaacttca
aaagcctgccgtggcaacctggtgtaccattctgccgtgttaggtatcagtgatctcatg
agtcagaggaactgttccaaggatggacccacatcctccaccaacccggaagtgacccat
gacccctgtaactaccacagccatgggggagtcagagaacacaggggaggggaccagaga
cctcccaattaccttttctgtggcttgttcggagatcctcaccttcgaactttcaaggat
cacttccaaacgtgcaaagtggaaggggcctggccactcatagacaacaattacctttcg
gttcaagtgacgaacgtgcctgtggtccctggatccagcgcaactgccacgaacaagatc
accattatcttcaaagcacagcatgagtgcacggatcagaaggtttaccaagctgtgaca
gatgacctgccggctgcctttgtggatggcaccaccagtgggggggacggtgatgtgaag
agtcttcacatcgtggagaaggagagtggccgatacgtagagatgcatgcccgctacata
ggcaccacagtgtttgtgcgacagctgggtcgctacctaaccctcgctatccggatgccc
gaagacttggccatgtcctacgaggaaagccaggacttgcagctgtgcgtgaatggctgc
cccatgagtgaatgcattgatgatggacaaggccaggtgtctgctatcctggggcacagc
ctgccccacaccacctcagcacaggcctggcctggctacacactggagactgccagcacc
caatgccaagagaagatgccagtgaaggacatctatttccagtcttgtgtctttgacctg
ctcaccactggtgatgccaactttactgctgcggcccacagtgccttggaggacgtggca
gcgctgcacccgagaaaggaacgctggcacatattccccagcagccatgggggacacagc
gatctgcctgttggtcttggactcacgtgcttgatccttactatggttttgtag

DBGET integrated database retrieval system