KEGG   Rattus norvegicus (rat): 308751
Entry
308751            CDS       T01003                                 

Gene name
Wdr73
Definition
(RefSeq) WD repeat domain 73
Organism
rno  Rattus norvegicus (rat)
SSDB
Other DBs
NCBI-GeneID: 308751
NCBI-ProteinID: NP_001100995
RGD: 1306429
Ensembl: ENSRNOG00000010664
UniProt: B0BN27
Position
1q31
AA seq 371 aa
MELAEDWLVESLRLYQDFHAFDLSGATRVLEWVGEKGVFVAGYESLKKNEILHLILPLRL
SVKENQGLYPERDFKVRHGGFSDRAVFDLKHVPDTRLLVTSGLPGCYIQVWQIREDNDVI
EAVSTIDVQDKEESLWPRVSIFCSAAPGILHGARLSGLRTVDVESRKITYSSDTTDSESL
SSLQVLDADTFAFCGTSGRLGLVDTRQKWAPLETVSPRAGSSGERWCAEVRSKGQGPGPC
IASLGSDGQLCLLDPRNLRDPVSSAQCPVFKSSPDPELLRVTWAPGLDNCLAISGFDGTV
QIYDVTSWDGKKTQVEALFIHKGHIFLDGNEVESAPLVTTHTWHPSKPRTLLSAASDAAL
HVWDWVDLQAS
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggagctcgcagaggactggctcgtggagtctttgcgcttgtaccaagacttccatgca
tttgacctctcaggagccactcgagttcttgaatgggttggtgaaaaaggagtctttgtt
gctggttatgaaagtttgaaaaaaaatgagattcttcatttgattctacctctaagactc
tctgtaaaggaaaaccagggcttatacccagagagggacttcaaagtacgccacggagga
ttctcagacagagctgtctttgacctaaagcacgtgccagataccaggttgctggtgacc
agtgggcttccagggtgttacatacaagtgtggcaaattagagaagacaacgatgtcatt
gaagctgtcagtaccattgatgtgcaggacaaagaggagagtctctggcctcgggtctct
atcttctgctctgcggcgcctgggatcctccatggggcgcggctcagcggcctgaggact
gtggatgtagaatcccggaagatcacatacagctcagatacaaccgacagtgagtccctg
agcagccttcaagtcctagatgcagatacctttgctttctgtggcacctcaggtcgcctg
gggcttgtggacacccgccagaagtgggcgccattggagactgtcagcccccgcgctggc
tctagtggagagagatggtgtgcagaagttaggagcaagggccaaggccctgggccctgc
attgccagccttggctcagatgggcagctctgtctccttgacccccggaatctccgtgat
cctgtgagctcagcccagtgcccagtgttcaagtccagccctgacccagagctgctgcgg
gtgacctgggctccaggcctggacaactgcttggctatttcaggctttgatgggacggtg
caaatctatgatgtcacatcatgggatggaaagaaaacccaggtggaggctcttttcatc
cacaaaggccacatcttcctggatgggaatgaggtcgagtctgctcctctggtcaccacc
catacctggcacccaagcaaacccagaactttgctgtcagcagcaagcgatgccgctctg
catgtgtgggactgggttgacctccaggcctcctga

DBGET integrated database retrieval system