KEGG   Rattus norvegicus (rat): 308775
Entry
308775            CDS       T01003                                 

Gene name
Det1, RGD1309793
Definition
(RefSeq) de-etiolated homolog 1 (Arabidopsis)
  KO
K10571  de-etiolated-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    308775 (Det1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    308775 (Det1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     308775 (Det1)
SSDB
Motif
Pfam: Det1
Other DBs
NCBI-GeneID: 308775
NCBI-ProteinID: NP_001032271
RGD: 1309793
Ensembl: ENSRNOG00000018515
UniProt: Q498E1
Position
1q31
AA seq 500 aa
MDHHVSTIKPRRIQNQNVIHRLERRRISSGRAGTHWHQVRVFHQNVFPNFTVVNVEKPPC
FLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVSIRGRL
FERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFYEVYRNSESV
TPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIH
VFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLL
VYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPS
QASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQ
IQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPK
TCGDHPIRYFITTTTTNCFK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggatcatcatgtttccacgattaaacctcgaagaatccaaaatcaaaacgtcatccac
cgcttagagcgccggcgcatcagttcaggcagggcagggacccactggcatcaggtccga
gtcttccaccagaatgtcttccccaacttcacggttgtcaacgttgaaaagcctccttgt
ttcttgcgtaaattctcgcctgacgggcgctactttattgctttttcgtctgaccagaca
tctcttgaaatctacgagtaccagggctgtcaggcagcagaggacctcttgcagggatat
gaaggggagatcttgtccaatggtaatgaccagaggtcggtcagcatccgaggccggctc
tttgaacgtttttttgtcctgctgcacattaccaatgtagcggccaatggcgagcacttg
aaccgggagtgtagcctcttcacggacgactgccgctgtgtcatcgtgggctccgctgcc
taccttccagacgaacctcaccctcctttctatgaggtctatcggaacagtgagtcggtg
acccctaacccacggtcccctctcgaagactattccctccacatcatcgaccttcacact
ggccgtttgtgtgacacacgcacattcaagtgtgacaaggtggtcctgtcacacaatcaa
gggctgtacctatacaagaacatcctggccatattgtctgtgcagcagcagaccattcat
gtcttccaggtgactcctgaaggcacgtttattgacgttcggaccattggccgcttctgc
tacgaggatgacctgctcactgtgtctgccgttttccccgaggtgcagcgggacagccag
acaggcatggccaaccctttcagggaccctttcatcaactccttgaagcaccggttgctg
gtttacctctggcgcagggcagagcaagacggtagcgccatggcgaagagacgtttcttc
cagtactttgaccagctgcggcagctgcgcatgtggaagatgcagcttctggatgagaac
cacctgttcatcaagtacaccagcgaggacgtagtgacgctgcgggtcacagacccatct
caggcctccttctttgtggtgtacaacatggtgacaacagaggtgattgccgtctttgag
aacacgtcagatgaacttctggagctctttgagaacttctgtgacctcttccgcaatgcc
accctgcacagtgaagtccagttcccttgctcagcttctagcaacaactttgcaaggcag
attcagcgccggttcaaagacacaattataaatgccaagtatggagggcacactgaagct
gtgcgccgactgctaggccagctccccatcagtgcccagtcttacagtggaagcccctac
ctggatttgtctctcttcagctacgatgacaagtgggtgtcagtcatggagcgacccaag
acttgtggagatcacccgatcaggtactttatcaccaccacaactacaaactgcttcaag
tga

DBGET integrated database retrieval system