KEGG   Rattus norvegicus (rat): 308831Help
Entry
308831            CDS       T01003                                 

Gene name
Tenm4, Odz4
Definition
(RefSeq) teneurin transmembrane protein 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ten_N Tox-GHH EGF_2 RHS_repeat NHL EGF_Tenascin CarboxypepD_reg
Motif
Other DBs
NCBI-GeneID: 308831
NCBI-ProteinID: NP_001178557
RGD: 1304658
Ensembl: ENSRNOG00000011151
UniProt: F1LZ38
Position
1q32
AA seq 2794 aa AA seqDB search
MEPDHSALSAARAQFVDVEEREPEAMDVKERKPYRSLTRRRDAERRYTSSSADSEEGKGP
QKSYSSSETLKAYDQDARLAYGSRVKDMVPQESEEFCRTGTNFTLRELGLGEMTPPHGTL
YRTDIGLPHCGYSMGASSDADLEADTVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLT
DTEHENTETDHPSGLQNHPRLRTPPPPLPHAHTPNQHHAASINSLNRGNFTPRSNPSPAP
TDHSLSGEPPAGSAQEPTHAQDNWLLNSNIPLETRNLGKQPFLGTLQDNLIEMDILSASR
HDGAYSDGHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFSRPAFNLKKPSK
YCNWKCAALSAILISATLVILLAYFVAMHLFGLNWHLQPMEGQMYEITEDTASSWPVPTD
VSLYPSGGTGLETPDRKGKGAAEGKPSSLFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQ
VFIDHPVHLKFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEARSLEGPQR
QSRGTVPPSSHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTTIESVENCPSNCYGNGD
CISGTCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVAC
SSHGTCIMGTCICNPGYKGESCEEVDCMDPTCSSRGVCVRGECHCSVGWGGTNCETPRAT
CLDQCSGHGTFLPDTGLCNCDPSWTGHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAAC
DQRACHPRCAEHGTCRDGKCECSPGWNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLN
GWHCVCQLGWRGAGCDTSMETACGDSKDNDGDGLVDCMDPDCCLQPLCHVNPLCLGSPDP
LDIIQETQAPVSQQNLHSFYDRIKFLVGRDSTHVIPGENPFDGGHACVIRGQVMTSDGTP
LVGVNISFINNPLFGYTISRQDGSFDLVTNGGISIILRFERAPFITQEHTLWLPWDRFFV
METIIMRHEENEIPSCDLSNFARPNPVVSPSPLTSFASSCAEKGPIVPEIQALQEEIIIA
GCKMRLSYLSSRTPGYKSVLRISLTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYY
FIWDKTDVYNQKVFGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDK
HHALNIQSGILHKGNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVAL
TCGSDGSLYVGDFNYIRRIFPSGNVTNILEMRNKDFRHSHSPAHKYYLATDPMSGAVFLS
DTNSRRVFKIKSTTVVKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITV
DKFGLIYFVDGTMIRRVDQNGIISTLLGSNDLTSARPLSCDSVMDISQVRLEWPTDLAIN
PMDNSLYVLDNNVVLQISENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHATLESATALAV
SHNGVLYIAETDEKKINRIRQVTTSGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAK
LNTPSSLAVCADGELYVADLGNIRIRFIRKNKPVLNTQNMYELSSPIDQELYLFDTSGKH
LYTQSLPTGDYLYNFTYTGDGDITHITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMG
TNSALRSVTTQGHELAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSS
FRSDTDSSVHVQVETSSKDDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANG
MEVALQSEPHLLAGTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHN
RNLLSLDFDRVTRTEKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSPGGHIAG
IQRGIMSERMEYDQAGRITSRIFADGKMWSYTYLEKSMVLHLHSQRQYIFEFDKNDRLSS
VTMPNVARQTLETIRSVGYYRNIYQPPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYG
KLSKLAETLYDTTKVSFTYDESAGMLKTVNLQNEGFTCTIRYRQIGPLIDRQIFRFTEEG
MVNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIIT
TAVMTHTKHFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYE
YDADGQLQTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDLRDRITRLGDVQYKM
DEDGFLRQRGGDVFEYNSAGLLIKAYNRASGWSVRYRYDGLGRRVSSKSSHSHHLQFFYA
DLTNPTKVTHLYNHSSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGL
MIKQILYTAYGEIYMDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHEL
WKRLSSSSIVPFHLYMFKNNNPISNSQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDTD
AMEPSYELVSTQMKTQEWDNSKSILGVQCEVQKQLKAFVTLERFDQLFGSTITSCQQAPE
TKKFASSGSIFGKGVKFALKDGRVTTDIISVANEDGRRIAAILNNAHYLENLHFTIDGVD
THYFVKPGPSEGDLAILGLSGGRRTLENGVNVTVSQINTMLGGRTRRYTDIQLQYRALCL
NTRYGTTVDEEKVRVLELARQRAVRQAWAREQQRLREGEEGLRAWTDGEKQQVLNTGRVQ
GYDGFFVTSVEQYPELSDSANNIHFMRQSEMGRR
NT seq 8385 nt NT seq  +upstreamnt  +downstreamnt
atggagccagaccactcagccctgagtgcggcaagggcccaatttgtggatgtggaagag
cgtgagccagaggccatggacgtgaaggagaggaagccctatcgctcgctgaccaggcgt
cgcgatgctgagcgccgctacaccagctcatcagccgacagcgaggagggcaagggccca
cagaagtcctacagctccagcgagaccctgaaggcatatgaccaagatgctcgcctagcc
tatggcagccgcgtcaaggacatggtaccacaggagtcggaggagttctgccgcacaggc
actaatttcactcttcgagaactgggactgggagagatgactccccctcatggaaccctc
tacagaacagatatcggcctcccacactgtggctattccatgggggccagctctgatgca
gacctggaagcagacactgtgctgtcccctgaacacccagtgcgcctgtggggccggagc
actcggtcagggcgaagttcctgcctgtctagccgggctaactccaacctcacactcacg
gacacagagcatgagaacaccgaaaccgatcatcccagcggcctgcagaaccaccctcgg
ctccggacgcctccaccaccactccctcacgcccatacccccaaccagcaccacgcggcc
tccatcaactctttgaacaggggtaacttcaccccaaggagcaaccccagcccagcaccc
acagaccattcactctccggggagcccccagcaggcagcgcccaggagccaactcatgcc
caggacaactggctactcaacagtaacatcccactggagaccagaaacctaggcaagcag
ccattcctagggacattgcaggacaacctcattgagatggacattctcagcgcctcccgc
catgatggggcttacagtgacgggcacttcctcttcaagcccggaggcacctccccactc
ttctgcaccacgtccccagggtaccccctaacgtctagcaccgtgtattcgcccccaccc
cggcccctgccccgcagcaccttttcgagaccagcctttaacctcaagaagccttccaag
tactgcaactggaagtgtgcggcactaagcgccatcctcatctcagctacgctcgtcatc
ctgctcgcatactttgtggccatgcacctgtttggcctaaactggcacctgcagccgatg
gaggggcagatgtatgagatcacggaggacacagccagcagctggcctgtgccaacggac
gtctccctgtatccctcagggggcactggcttagagacccctgacaggaaaggcaaagga
gccgcagaaggaaagccaagtagtttatttccagaggacagtttcatagactctggagaa
atcgatgtggggagacgggcttcccagaagatcccgcctggaacgttctggagatctcag
gtgttcatagaccaccctgtgcatctgaagttcaatgtgtctctggggaaagcagctctg
gttggcatttacggcagaaaaggccttcctccttctcatactcagtttgactttgtagag
ctactggatggaagaaggctgctaacccaagaggcaaggagcctggagggtcctcagcgc
cagtctcgaggcaccgtccccccatccagccatgagaccggtttcatccagtatctggat
tcaggaatctggcacctggccttttacaatgatgggaaagagtctgaagtggtttccttc
ctcaccaccaccattgaatcagtggagaactgccccagcaactgctatggtaacggtgac
tgcatttccgggacctgccactgcttcctgggttttctgggacccgactgtggccgagca
tcctgccccgtgctatgcagcgggaacggccagtacatgaagggcaggtgcctgtgccac
agtggctggaagggtgcagagtgcgacgtgcctaccaaccagtgcatcgacgtggcctgc
agcagccacggcacctgcatcatgggcacctgcatctgtaaccctggctacaagggcgag
agctgtgaggaagtggactgcatggaccccacgtgctccagtaggggtgtctgtgtgaga
ggcgagtgccactgctctgtgggatggggaggcaccaactgcgagacacccagggccacg
tgcttggaccagtgctcaggccatggaaccttcctcccagacaccgggctctgcaactgt
gacccaagctggactggacatgactgttccattgagatctgtgctgctgactgtggtggc
cacggcgtctgtgtaggaggcacctgccgctgtgaggatggctggatgggggctgcatgc
gaccaacgggcctgccacccacgctgtgcagaacacgggacctgccgggatggcaagtgc
gaatgcagccctggctggaacggcgaacactgcaccattgctcactatctggatagggta
gttaaagagggctgtcctggcttgtgcaatgggaatggcagatgtactctggacctgaat
gggtggcactgtgtctgccagctgggctggcgaggagctggctgcgacacctccatggaa
acagcctgtggagacagcaaagacaacgatggagatggcttagtagactgcatggaccct
gactgctgcctccagcccctctgccatgtcaacccgctgtgcctaggctcccctgatcct
ctggacatcatccaagagacacaggccccggtatcccagcagaacctgcactccttctac
gaccgaatcaagtttctcgtgggcagggacagcacgcatgtcatccctggggagaacccc
tttgatggaggacatgcttgtgtcatccgtggacaagtgatgacttcagatgggacccca
ctggttggcgtgaacatcagtttcatcaataaccctctctttggatacacaatcagtcgg
caagatggcagctttgacctggtcacaaacggcggcatctccatcatcctgagattcgaa
cgggcacccttcatcacacaggagcataccctctggctaccctgggaccgcttctttgtc
atggaaaccatcatcatgagacacgaggagaatgagatccccagctgtgacctgagcaac
tttgcccgacccaacccagtggtctctccatccccactgacatccttcgctagctcctgt
gctgagaaaggacccattgtcccagaaatccaggctctgcaagaggaaatcatcattgct
ggctgcaagatgaggttgagctatctgagcagccgcacccctggctataagtctgtcctg
aggatcagtctcacacatcccaccatccccttcaacctcatgaaggtccacctcatggta
gcagttgagggtcggctcttcaggaagtggtttgctgcggctcctgacctatcctattac
ttcatctgggacaagacagacgtctacaaccagaaagtgtttgggctctcagaagccttt
gtttccgtgggttatgaatatgaatcttgcccagatctgatcctgtgggagaaaaggaca
gcggtgctgcagggctatgaaatcgatgcctccaagctggggggctggagtctggataag
caccatgccctgaacatccagagtggcatcctgcacaaagggaatggagagaaccagttc
gtgtcccagcagccaccagtcatcggcagcatcatgggcaatgggcgcaggaggagcatc
tcctgccccagctgcaatggcctcgcggatggcaacaagctcctagcacccgtggccctc
acctgtggttctgatgggagtctctacgtgggagacttcaactacatccgaaggatcttc
ccctctggaaatgtcaccaacatcctggagatgagaaataaagatttcagacatagtcac
agcccagcacacaaatactacctggctacagaccccatgagcggggccgtcttcctgtct
gacaccaacagccggcgggtcttcaagatcaagtccaccaccgtggtgaaggacctggtc
aagaactccgaggtggtagcagggactggtgaccagtgcctccccttcgatgatactcgc
tgcggagacggtgggaaagccacagaagccacgctcactaatcccaggggaattacagtg
gacaagtttgggctcatttacttcgtggatggcaccatgatcagacgtgttgatcaaaat
gggatcatctcaactttgctgggctccaatgatctcacctcagccaggcccctcagctgt
gactctgtcatggatatttctcaggttcgcctggagtggcccacagacttagccatcaac
ccaatggataattccctctatgtcctcgacaacaacgtggtcctacaaatctccgaaaac
caccaggtacgcattgtcgctgggaggcccatgcactgccaggttcctggcatcgaccac
ttcctgctgagcaaggtagccatccacgcaaccctggagtcagccactgctttggccgtt
tcacacaatggagtcttgtatatcgctgagaccgacgagaagaagatcaaccgtatcagg
caggtcacgacaagtggtgagatctcactggttgctggtgcccccagcggctgcgactgt
aaaaacgacgccaactgcgactgcttctctggagatgatggctacgccaaggacgcaaag
ctgaacaccccatcttccttggccgtgtgtgcagacggggagctctacgtggccgacctt
ggaaacatccggatccggtttatccggaagaacaagcctgtcctgaacacccagaacatg
tatgagctgtcctcccccatcgaccaggagctgtacctctttgacaccagtggcaagcat
ctgtacactcagagcctgcccacaggagactacctgtacaacttcacttacacgggggac
ggggacatcacacacatcacagacaacaatggcaacatggtgaacgtccgccgagattct
accgggatgcctctctggctggtagtcccagatggccaggtgtactgggtaaccatgggc
accaacagcgcactcagaagtgtgaccacgcaaggacacgagctggctatgatgacatac
catggcaactctggcctcttggcgaccaaaagcaatgaaaacgggtggacaacgttttat
gagtatgacagttttggtcgcctgacaaacgtgacctttccaactggccaggtgagcagt
ttccgaagcgatacagacagctcagtgcacgtgcaggtagagacctcaagcaaagacgat
gtcaccataaccaccaacctgtctgcctcgggtgccttctacactctgttacaagaccaa
gtccggaacagctactacatcggggccgatggctccctgaggctgctgctggccaatggt
atggaagtggctctgcagagcgagccacacctgctggctggcactgtcaaccccactgta
ggcaagaggaatgtcacgctgcccattgataatggcctcaacctggtggaatggcgacag
cgcaaggagcaggctcgtggtcaggtcacagtctttggacgccgtctgcgggttcacaac
cgaaacctcttatccttggactttgaccgtgtcacacgcacagagaagatctatgacgac
catcggaagttcacccttcggatcctatatgaccaggcggggaggcctagcctctggtca
cctagcagcaggctgaatggtgtcaatgtgacctactcccctggaggtcacattgctgga
atccaaaggggcatcatgtctgagagaatggagtatgaccaggcaggccgcatcacatcc
cggatctttgcggatgggaagatgtggagttacacgtacttagagaagtccatggtgctc
cacctccacagccagaggcagtacatcttcgagtttgacaagaacgaccgcctctcttct
gtgaccatgcccaacgtagcccggcagacgctggagaccattcgctcagtgggctactac
aggaacatctaccaaccgccagagggcaatgcctcagtcatacaggacttcactgaggat
ggacacctgttacataccttctacttgggcactggccgcagggtgatttacaagtacggc
aagttgtcaaagctggctgagaccctgtacgacaccaccaaggtaagcttcacctacgac
gagagtgcgggcatgctgaagacggtcaacctacagaatgagggcttcacctgcactatc
cgctaccgtcagattgggcccctgatcgaccgtcagatcttccgattcactgaagaaggc
atggtcaatgcccgttttgattacaactatgacaacagtttccgcgtgaccagcatgcag
gccgtgatcaacgagaccccgctgcccatcgatctctaccgctatgatgatgtgtcaggg
aagacagaacagtttgggaagtttggtgtcatctactatgacatcaaccagatcattacc
acagccgtcatgacgcacaccaagcatttcgacgcttacggcaggatgaaggaagtgcag
tacgagattttccggtcactcatgtactggatgactgttcagtatgataacatgggacgg
gtggtgaagaaggagctcaaggtgggaccctacgccaacaccacccgctactcctatgag
tacgacgccgatggccagctgcagacagtctccatcaatgacaagccactctggcggtac
agctatgacctcaacggaaacctccacttgctgagccctgggaacagcgcgcggctcaca
ccgttgcggtacgacctccgagaccgcatcacgaggctgggcgatgtgcagtacaagatg
gatgaagacggcttcctaaggcagcgaggcggggatgtcttcgagtacaattcagccggc
ctgctcatcaaagcctacaaccgggctagtgggtggagtgtcaggtaccgctatgacggc
ctggggcggcgagtatccagcaagagcagccacagccaccacctacagttcttctacgca
gacctgaccaaccccaccaaggtcacccacctctacaaccactccagctctgagatcacg
tccctctactatgatctgcaagggcacctctttgccatggagctgagcagcggcgatgag
ttttacatagcttgtgacaatatcgggaccccccttgctgtcttcagtggaaccggcctg
atgattaagcagatcctatacacagcctatggggagatctacatggacacgaaccccaac
ttccagatcatcattggctaccacggcggcctttatgatccactcaccaaacttgtccac
atgggccgacgggattatgatgtgctggccggacgctggacgagcccagaccacgaactc
tggaaacgcctgagtagcagcagcatcgtgccttttcacctctacatgtttaagaacaac
aaccccatcagcaactctcaggacatcaagtgcttcatgacagatgtcaacagctggctg
cttaccttcggattccagctgcacaacgtgatacctggctaccccaagccagacacagat
gccatggagccctcctatgagctcgtgagcacacagatgaaaactcaggaatgggacaac
agcaagtccatcctcggggtacagtgtgaagttcagaagcaactcaaggccttcgttacc
ttagaacgctttgaccagcttttcggctccaccatcaccagctgccaacaggccccagag
acaaagaagtttgcctccagtggttccatctttggcaagggggtcaagtttgccttgaaa
gacggtcgagtgaccactgacatcatcagtgtggctaatgaggacgggcggaggattgcg
gccatcttgaacaatgcccactatctagagaaccttcacttcaccatcgacggggtggac
acccactactttgtgaaaccaggaccttcggaaggtgacctggccatcctgggcctcagt
ggggggcggagaactctggagaacggggtcaacgtcactgtgtcccaaatcaacaccatg
ctcggtggcaggactagacgctacactgacatccagctgcagtacagggcactgtgcctg
aacacccgctatgggacaaccgtggacgaggaaaaggtacgggtgctggagctggccagg
cagagggctgtacgccaggcctgggcccgagagcagcagagactgcgggaaggggaagag
ggcctgcgggcctggacagacggggagaagcagcaggtgctgaacacggggcgggtgcaa
ggctatgacggcttctttgtgacttccgtggagcagtacccagaactgtcagacagcgcc
aacaacatccacttcatgagacagagcgagatgggccgaaggtga

DBGET integrated database retrieval system