KEGG   Rattus norvegicus (rat): 308843
Entry
308843            CDS       T01003                                 

Gene name
Tsku, Eiih
Definition
(RefSeq) tsukushi, small leucine rich proteoglycan
  KO
K08130  tsukushi (leucine-rich repeat-containing protein 54)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    308843 (Tsku)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   Others
    308843 (Tsku)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_6 LRR_5
Other DBs
NCBI-GeneID: 308843
NCBI-ProteinID: NP_001009965
RGD: 1359311
Ensembl: ENSRNOG00000027784
UniProt: Q6QMY6
Position
1q32
AA seq 353 aa
MLCTLFLLLLALGIVQTTRPCFPGCQCEEETFGLFDSFSLIRVDCSSLGPHIVPVPIPLD
TAHLDLSSNRLETVNESVLGGPGYTTLAGLDLSHNLLTSITPTAFSRLRYLESLDLSHNG
LAALPAEVFTSSPLSDINLSHNRLREVSISAFTTHSQGRALHVDLSHNLIHRLLPYPARA
SLSAPTIQSLNLSWNRLRAVPDLRDLPLRYLSLDGNPLATINPGAFMGLAGLTHLSLASL
QGILQLPPHGFRELPGLQVLDLSGNPKLKWAGAEVFSGLGLLQELDLSGSSLVPLPETLL
HHLPALQSVSVGQDVQCRRLVREGAYHRQPGSSPKVVLHCGDTQESARGPDIL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgttgtgcaccctgttcctgctactgctggccctgggcatagtgcagacaactcggcca
tgtttccctggctgccagtgtgaggaagagacgtttggcctctttgacagtttcagcctg
atccgagtggactgcagcagcctgggcccccacattgtgcctgtgcccatccctctggac
acagcccacctggacctgtcttccaaccggctagaaaccgtgaatgagtcagtcctggga
gggccaggctataccacactggctggcctggatctcagtcacaacctcctcaccagcatc
acgcccactgccttctcccgccttcgctacctggagtcactggacctcagtcacaatggc
ctggcagccctgccagcagaggttttcaccagctcccccttgagtgatatcaacctgagc
cataatcgacttagagaggtctcgatatctgccttcaccacccacagccaggggcgggca
ctgcacgtggacctatcccacaatcttatccaccgcctgctcccctatccagccagggcc
agcctgtccgcacctaccattcagagcctgaacctgtcctggaaccggctccgagccgtg
cccgatctccgagacctacccctgcgttacctgagcctggatgggaaccctctggctacc
atcaacccaggcgccttcatggggctggcgggcctcacccacctttcactggcaagccta
cagggtatcctccagctaccaccccatggcttccgagagctcccaggccttcaggtcctg
gacttgtctggtaaccccaagctcaagtgggcaggagccgaggtattttcaggcctgggt
ttgctgcaagaactagacctgtctggctccagcctggtgcccctgcctgagacgctgcta
catcacctccctgctttacagagtgtcagtgtaggccaagatgtgcagtgccggcgtctg
gtacgggagggtgcctaccaccgccaacccggttccagccctaaggtagtcctgcactgt
ggagacacccaggaatctgccaggggcccagacatcttgtga

DBGET integrated database retrieval system