KEGG   Rattus norvegicus (rat): 308857Help
Entry
308857            CDS       T01003                                 

Gene name
Dnajb13, Tsarg1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B13
  KO
K09519  DnaJ homolog subfamily B member 13
Organism
rno  Rattus norvegicus (rat)
Brite
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   308857 (Dnajb13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ
Motif
Other DBs
NCBI-GeneID: 308857
NCBI-ProteinID: NP_001005885
RGD: 1359131
Ensembl: ENSRNOG00000017975
UniProt: Q5YKV6
Position
1q32
AA seq 316 aa AA seqDB search
MGMDYYAVLQVNRNSEDAQIKKAYRKLALKNHPLKSNEPTAPEIFRQIAEAYDVLSDPVK
RGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPEKVFHEFFGGDNPFSEFFDAEGND
IDLNFGGLRGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKIL
TIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREQDNLFFVYPIPLGK
ALTCCTVEVKTLDDRLLNIPINDIVHPKYFKMVPGEGMPLPEDPTKKGDLFIFFDIQFPT
RLTPQKKQMLRQALLT
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggggatggattactatgctgtgctccaggtcaatcgcaactcagaggatgcccagatc
aagaaggcataccggaagcttgccctgaagaaccacccattaaagtcaaatgagccgact
gcaccagaaatattcaggcaaatagcagaagcctacgacgtgctgagcgacccagtgaaa
cgaggcatctatgacaagtttggcgaggaaggcctgaagggtgggattcctctggagttt
ggatcccagactccatggacaacgggctatgtcttccatggcaaccctgaaaaagtgttc
cacgagttttttggaggagacaaccccttcagtgaattttttgatgcagaaggaaatgat
atagatttgaattttggggggcttcggggccgaggggtccagaaacaagaccctccaatt
gaacgagacctctatttgtccctggaggacttattctttggctgcaccaaaaaaattaag
atctcccgaagggtgctaaatgaagatgggtattcctctaccatcaaggacaagatcctg
accatcgatgtgaggcctgggtggaggcagggcacgcgcatcacctttgagaaggaaggg
gaccagggccccaacattatcccggccgatattatcttcatcgtaaaggagaagctgcac
cctcgcttccgcagggagcaggacaacctcttctttgtgtaccccattcctttgggcaag
gcccttacctgctgcactgtggaggtgaagacccttgatgaccggctgctcaacatcccc
atcaacgacattgtccaccccaagtacttcaagatggtgccaggtgaggggatgccgctg
cctgaggaccccaccaagaagggagacctcttcatcttcttcgacatccagttccccacc
cgtctcacaccccagaagaagcagatgctgcgccaggcactgctgacctaa

DBGET integrated database retrieval system