KEGG   Rattus norvegicus (rat): 308869
Entry
308869            CDS       T01003                                 

Gene name
Lamtor1, p18
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 1
  KO
K20397  ragulator complex protein LAMTOR1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    308869 (Lamtor1)
SSDB
Motif
Pfam: LAMTOR
Other DBs
NCBI-GeneID: 308869
NCBI-ProteinID: NP_954533
RGD: 735078
Ensembl: ENSRNOG00000020016
UniProt: Q6P791
Position
1q32
AA seq 161 aa
MGCCYSSENEDSDQDQEERKLLLDPSNTPTKALNGAEPSYHSLPSARTDEQALLSSILAK
TASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLA
SEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP
NT seq 486 nt   +upstreamnt  +downstreamnt
atggggtgctgctatagcagcgaaaacgaggactcggaccaggaccaggaggagaggaag
ctgttgttggaccccagtaacacccctaccaaagccctcaatggagccgagcccagctac
catagcctgccttcagctcgcacagatgagcaggccctgctttcctccatccttgccaag
acagctagcaacatcattgatgtgtctgccgcagactcccagggcatggagcagcatgag
tacatggaccgggcaaggcagtacagtacccgcttggctgtgcttagcagcagtctgacc
cattggaagaagctgccaccgctgccatctctcaccagccagccccaccaagtgctggcc
agcgagcctatccctttctctgacttgcagcaggtctccaggatagctgcttatgcctat
agtgcactttctcagatccgcgtggatgcgaaagaagagctggttgtacagtttgggatc
ccatga

DBGET integrated database retrieval system