KEGG   Rattus norvegicus (rat): 308896
Entry
308896            CDS       T01003                                 

Gene name
Usp47
Definition
(RefSeq) ubiquitin specific peptidase 47
  KO
K11857  ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    308896 (Usp47)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    308896 (Usp47)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     308896 (Usp47)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   308896 (Usp47)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    308896 (Usp47)
SSDB
Motif
Pfam: UCH UCH_1 Ubiquitin_2 ubiquitin Dockerin_1
Other DBs
NCBI-GeneID: 308896
NCBI-ProteinID: NP_001101012
RGD: 1310411
Ensembl: ENSRNOG00000026754
UniProt: F1MAA1 B2GVC1
Position
1q33
AA seq 1355 aa
MVPGEENQLVPKEIENAAEEPRVLCIIQDTTNSKTVNERITVNLPASTPVRKLFEDVANK
VGYINGTFDLTWGNGINTADLAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQMLLD
DSSHVDDSVHDRFIGPLPREGSVASTSDYVSQSYSYSSILNKSETGYVGLVNQAMTCYLN
SLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSF
GWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWR
IDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFL
HFPYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTFIDIEDEKSPQTESCTDSGAE
NEGSCHSDQMSNDFSTDDAVDEGICLESSTGSEKISKPGLEKNSLMYELFSVMVHSGSAA
GGHYYACIKSFSDDQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLI
YRLKDPTRNAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPVKQV
MMENKLEVHKDKTLKEAVEMAYKMMDLEDVIPLDCCRLVKYDEFHDYLERSYEGEEDTPM
GLLLGGVKSTYMFDLLLETRKPDQIFQSYKPGEVMVKVHVVDLKAETVAAPVTVRAYLNQ
TVLEFKQLISKATHLPAEPMRIVLERCYNDLRLLSMPSKTLKAEGFFRSNKVFVESSETV
DHQAAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTAYQKAGGDSGNVDDDCERAK
GPAGSLKSVDAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERGSSTS
VDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADSAQIP
LANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKADPYT
ADEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYTSNQEFETVRLNET
LSSFSDDNKITIRLGRALKKGEYRVKVCQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELI
PQLREQCGLDLSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMK
SMSQLAILTRRWRPSEMKLDPFQELVLESNSVDELREKLSEISGIPLEDIEFAKGRGTFP
CDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDRTEEVMELTDEQRNELMKKES
SRLQKTGHRVTYSPRKEKALKIYLDGAPNKDVAQD
NT seq 4068 nt   +upstreamnt  +downstreamnt
atggtgcccggcgaggagaaccaactggtcccgaaggagatagaaaatgctgctgaagaa
cctagagtcttatgtataatacaggacactactaactcaaagacagtgaatgaacggatc
acagtgaatttaccagcatctaccccagtcagaaagctctttgaagatgtggccaacaaa
gtaggctacataaacggaacctttgatttgacatggggaaatggaatcaatactgctgat
ttggcaccactggatcacaccagtgacaagtctcttcttgatgctaattttgagccagga
aagaagaactttctgcatttgacagataaagatggagaacagcctcagatgctattggat
gactccagtcacgtggacgacagcgtgcatgacaggtttataggtccacttccaagagaa
gggtctgtggcttctaccagtgattatgtcagccagagctactcctattcatcaattttg
aacaagtcagaaactggttatgtgggattagtaaaccaggcgatgacgtgctatttgaat
agccttttgcaaacactttttatgactcctgaatttaggaatgccttatataagtgggag
tttgaagagtctgaagaagatcctgtaacgagcatcccataccagcttcagaggcttttt
gttctgttacaaaccagcaaaaagagagcaattgagaccacagatgtcacaaggagcttt
ggatgggatagcagtgaggcttggcaacagcatgatgtacaagaactgtgccgtgttatg
tttgatgctttggaacagaaatggaagcaaacagaacaggctgatcttataaatgagctg
taccaaggcaaactgaaagactatgtgaggtgtctggaatgcggttatgaaggctggaga
attgacacgtaccttgatattccactggtcatccgaccttatgggtctagccaagcattt
gccagtgtggaagaagcattgcatgcatttattcaaccagagatcttggatggcccaaat
caatacttctgtgaacgttgtaagaagaagtgcgatgctcgtaagggccttcggtttttg
cactttccctatctgctgactttacagttgaaaaggtttgattttgattatacaaccatg
catagaattaaactgaatgatcgaatgtcatttccagaggagctggatatgagcacattt
attgatattgaagatgagaaatctcctcagactgaaagttgcactgatagtggagcggaa
aatgaaggcagttgccacagcgaccagatgagcaatgatttctccacggatgatgctgtt
gatgaagggatatgcctggagagcagtactgggagtgagaagatttcaaaacctggcctg
gaaaagaactccctgatgtatgagctcttctcggtgatggtacattcagggagtgctgct
gggggacactattatgcttgcataaagtctttcagcgacgatcagtggtacagtttcaat
gaccaacatgtgagcaggataacacaagaagacattaagaagacacacggtgggtcttca
ggaagcagaggctactactccagtgcttttgcaagctcaacaaatgcatatatgctgata
tacagactgaaggatccaacaagaaatgcaaaatttctggaagtggatgagtacccagaa
cacattaagaacctggtgcagaaggagagagaattggaagaacaggaaaagaggcaacga
gaaattgaacgaaacacatgcaagataaaattattctgtttacatcctgtgaaacaagta
atgatggaaaacaagttggaggttcataaggacaagacattaaaggaagcagtagaaatg
gcttataagatgatggatttagaagacgtgattcccttggattgctgtcgcctggtaaaa
tatgatgagtttcatgattacctggaacgatcctatgagggagaagaagatacgccaatg
gggctgcttctaggaggagtcaagtcaacgtacatgtttgatctgctgttggagacaaga
aagcctgatcaaatttttcagtcttataaacctggagaagtgatggtgaaagttcatgtt
gtcgatctgaaggcagagactgtcgctgctcctgtaacagtgcgtgcttatttaaatcag
acagttttggagttcaaacagctgatctcaaaggccacacacttacctgcagaacccatg
aggatcgtgctggagcgctgctacaacgacctgcgcctgctcagcatgcccagcaagacc
ctgaaggctgagggcttctttagaagtaacaaggtgtttgttgaaagctctgagacagta
gatcaccaggcagccttcacagactcccacttgtggaaactcctggatcgacatgcaaat
acaatccggttatttgttttgctgcctgaacaatctccagggtcttattcgaaaaggaca
gcataccagaaagctggaggggattctggtaatgtggacgatgactgtgaaagagccaag
ggacctgcaggaagtttaaagtctgtggatgccattctagaagagagcactgaaaaactc
aaaagcctgtcactgcagcagcagcaggatggggacaacggagacagcagcaaaagcact
gagacaagtgactttgagaatattgaatcccctctcaatgagaggggctcttccacctct
gtggataatcgagaacttgaacaacacattcagacttctgacccagaaaactttcagtct
gaagaacgctcagactcagatgtgaataatgaccggagtacaagttcggtagacagcgat
attcttagctctagtcacagcagcgacactttgtgcaatgcagacagcgctcagattcct
ttggccaatggactcgattctcacagtatcacaagtagtagaagaactaaggcaaacgaa
gggaaaaaggagacatgggacacagctgaagaagactctgggactgacagtgaatatgat
gagagtggcaagagcaggggggagatgcagtacatgtacttcaaagctgacccctacact
gcggacgaaggctctggggaaggacacaaatggttgatggtgcatgttgataagagaatc
accctggcagctttcaaacagcatttagagccttttgttggagtcctctcctctcacttc
aaggtttttcgagtgtacaccagcaatcaagagtttgagaccgtccggttgaatgagacc
ctttcatcattttcagatgacaataagatcacaatccgactggggagagcactgaagaag
ggagagtacagagttaaagtgtgccagctcttagtcaatgagcaagagccatgcaagttt
ctgctagacgccgtatttgctaaaggcatgactgtgcggcaatcgaaagaggagctgatt
cctcaactcagggagcagtgtggcttagacctcagcatcgacaggtttcgtctaaggaag
aaaacatggaagaatcctggcactgtttttttggattatcatatttatgaagaagatatt
aatatttctagcaactgggaagttttcctggaagttcttgatggtgtggagaagatgaag
tccatgtcacagcttgccattttaaccagacggtggaggccttcggagatgaagttggat
cccttccaggagcttgtgttggagagcaatagtgttgatgagcttcgagagaagctgagt
gaaatcagtgggattcctttggaagacattgaatttgccaagggtaggggaaccttcccc
tgtgatatttctgtccttgatattcatcaagatttggactggaaccctaaagtctctacc
ttgaatgtgtggcctctttatatctgtgatgatggtgccgtcatattttatagggataga
acagaagaagtaatggaattgacagatgagcaaaggaatgaactgatgaaaaaggaaagc
agccgactgcagaagacgggacatcgtgtgacatactcccctcgcaaagagaaagcactc
aagatctacctggatggggcgccaaataaagacgtagctcaagactga

DBGET integrated database retrieval system