KEGG   Rattus norvegicus (rat): 308899Help
Entry
308899            CDS       T01003                                 

Gene name
Mrvi1
Definition
(RefSeq) murine retrovirus integration site 1 homolog
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    308899 (Mrvi1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    308899 (Mrvi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1
Motif
Other DBs
NCBI-GeneID: 308899
NCBI-ProteinID: NP_001098680
RGD: 1309828
Ensembl: ENSRNOG00000017767
UniProt: D3ZDF3
Position
1q33
AA seq 855 aa AA seqDB search
MPHIPEDEEPPGEPQAAQTQDSPSAGPFCSPPTIILTGDASSPGGETDTNLVKRAPSPHR
RLSHRHLKVSTASLTSVDPLGHVIDLVNDQLPDISISEEDKKKNLALLEEAKLVSERFLT
RRGRRSRSSLGDAPSAVSPNLSSGASPASSRSCSFTISTPPGFDTCSGPQSPLPGSPAQQ
KGHEDDVFSSHLGEPNASKGLADRKQNDQRKVSQGRLAPRSPTVEKSKELSVEQKENFDP
LQHLEATPMAQTSGASVSGKMALNSPQPGPAEMELGRQLLKTAREDNPLPRTTVQGSGGT
ASPHSQGQGSAGELMGPKAGSKAEPRPPVSRPPLIRGVSWDSSPEEPGPLLQKVLAKLPL
AEEEKRFPGKAKPAKPPGLKDFQIQVQPVRMQKLTKLREEHILMRNQNLVGFKLPELSEA
AEQDKGVSSELAPAAEEEESKSGLDVMPNISDILLRKLRVHKSLTGSAPPLTEKEVENVF
VQLSLAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSASIWYHCEHRETYQ
KLLEDIAVLHRLAARLSSRAEVVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEF
KKLANQNSSRSCGPSEDGVPRTARSMSLTMGKNMPRRRVSVAVVPKFNALNLPGQAPSSS
PMPSLPALSESTNGRSSISTSPVLPALLENGKTNAEANCEVCAPVPLPSYPEETSQEAKA
RAEEEAYNKGYQEGVKKTEELQDLKEEEEEQKAESPQEPEEVEETQEDEKDQRSSKLEEL
VHFLQVMYPKLCQHWQVIWMMAAVMLVLSVVLGLYSSYNSCTEQADGPPGRSTCSAAQRD
SWWSSGLQQELPAEQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgccccacattcctgaggatgaggagccccccggagagccacaggcagcccagacccaa
gactctccctctgcaggaccgttttgcagccctcccacaatcatcctgacgggggatgcc
agttcacctggaggagagactgacacaaatctggtcaagagggctcccagcccccaccgc
aggctttcccaccgacacctgaaggtctccactgcctcgctgacttctgtggaccccttg
gggcacgtcattgacctggtaaatgaccagctgccggacatcagcatctcagaagaggac
aagaagaaaaacctggcacttctagaagaagccaagttggttagcgagcggttcctgacc
cgccgcgggaggagatcaaggagcagcctcggagacgccccatcagctgtttctccaaac
ctcagctctggagcttctcctgcatcctctaggagttgctcgttcaccatctccacacca
ccaggttttgacacatgcagtggcccacagtcccctctgccgggatcaccagcacagcaa
aagggacatgaggatgatgtcttctcgtctcacctcggagagcctaatgcctccaaaggg
ctagctgaccggaagcagaatgaccagaggaaagtgtctcaaggcagactggctcctcgc
tctcccacagtggagaaatccaaagaactttcagtagaacaaaaggaaaacttcgatccc
cttcagcatctggaggccacacccatggctcagacctctggagcaagcgtcagtgggaaa
atggcgctgaacagtccccagcctggccctgcggagatggagctggggaggcagcttctg
aagacagccagggaagacaaccctctgcccagaaccacagtccagggctcaggaggaacg
gcctccccacattctcagggacagggctctgctggagagcttatggggcccaaggctggc
tccaaggctgagccgaggcctcctgtgtcccggccccctctgattcggggggtctcctgg
gacagcagccctgaagaacctggtcccctgctgcaaaaggtgctcgctaagctgcctctg
gcagaggaagaaaagcggtttccaggcaaagccaagccagccaagccaccggggctcaaa
gacttccagatacaagtacagccggtgcgcatgcagaagctgaccaagcttcgggaggaa
cacatcctgatgagaaaccagaacctggtggggttcaagctccctgaactgagtgaagct
gcagagcaagacaaaggagtctcatctgagcttgccccagcagctgaggaagaagaatca
aagagtggtctggatgtgatgcccaacatttctgacatattgctacgtaaacttagggtt
cacaagtcactcactggaagcgcccctccgctcacagaaaaggaagtcgagaacgtgttt
gtacaactgtccttggcctttagaaatgacagctacaccttggagtctaggattaaccag
gctgaaagggaacgcaacttgacggaagagaacaccgagaaggaactggaaaacttcaaa
gcctctattacgtcctcagcatccatctggtaccactgcgagcaccgggagacctaccag
aagcttctggaagacatcgcagtcttgcatcgtctggctgcacgcctctccagccgggct
gaagtggtgggtgctgtgcgccaggaaaagcgcatgtcaaaggccacggaagtgatgatg
cagtatgtggagaatctgaagagaacgtacgagaaggaccatgctgagctcatggaattt
aagaaactcgcaaatcagaattctagtcgcagctgtgggccctctgaagacggggttcct
cgcacggcgcgatctatgtccctcacgatgggaaagaacatgccccgtcggagggtcagc
gttgctgtggttcccaagtttaatgccctgaacctgcctggccaagcccccagctcatca
cccatgccctctctcccagctctgtctgaatcgaccaacgggagaagcagcatctccacc
tctccagtgctgcctgcacttttggaaaatggaaagacaaatgcagaggctaactgtgaa
gtgtgcgcccctgtgccactcccaagctacccggaggagacgagccaagaggccaaggcc
agagcagaggaagaagcctacaacaaaggataccaggaaggggtaaagaagaccgaagaa
cttcaagacctgaaggaggaggaagaggaacagaaggcagagagtcctcaggaaccagaa
gaggtcgaagaaacccaggaagacgagaaggaccagagaagcagcaaacttgaagaactg
gtccacttcctacaagtcatgtatcccaaattgtgtcaacactggcaagtgatctggatg
atggccgctgtgatgctggtcttgagtgttgtgcttgggctctacagttcctataactcc
tgcacggagcaggccgacgggccccctgggagatccacctgctctgcagcccagcgggac
tcctggtggagctcgggactccagcaagagctgccagcagagcagtag

DBGET integrated database retrieval system