KEGG   Rattus norvegicus (rat): 308906
Entry
308906            CDS       T01003                                 

Gene name
Trim5, RGD1304579
Definition
(RefSeq) tripartite motif-containing 5
  KO
K10648  tripartite motif-containing protein 5 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    308906 (Trim5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    308906 (Trim5)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     308906 (Trim5)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    308906 (Trim5)
SSDB
Motif
Pfam: SPRY zf-RING_UBOX zf-C3HC4_4 zf-B_box zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-RING_6 zf-RING_5 zf-Nse zf-ANAPC11 U-box ASFV_p27 AAA_11 Bacillus_HBL TMPIT zf-RING_10 Exonuc_VII_L LprI
Other DBs
NCBI-GeneID: 308906
NCBI-ProteinID: NP_001014045
RGD: 1304579
Ensembl: ENSRNOG00000017191
UniProt: Q6AYT1
Position
1q32
AA seq 511 aa
MASEFVMNLKEEVTCPICLDLMVEPVSGDCGHSFCQACITLNYESSKCNQDEFICPVCRV
SYLFKNLRPNRHVANIVQRLKEFKSSPEEEPKVLSCARHGEKLQLFCKKDMMPICWLCER
SQEHRGHQTVLIEEVVQEYKEKLQAALQKLMADKKEFENWKDDLQKERTYWQNQIQKDVE
NVQSEFKGMRDIMDSEEKKELQKLMQEKEDIMSSLEESENEYSQQSKLLGDLILDVEHQL
QCSATEMLQGVENTIKRSHTFSMRKPKTIPKEQRRVFRAPDLQGMLQVLQEVTEAQRYWV
QVTLVESNNPNIFITADKRQIRYEDHQARHFARPTENCHAGVLGYPAIQSGKHYWEVDVS
GKGSWVLGLSDGSYLFNPIFRSNAERPPNPPLFRLNLSNDSHSRLSLSNDSHYQPKYGFW
VIGLWGNSVYNAFEECTFTGKPSVLTLSLMVRPCRVGIFLDCAAGTLSFYNISNHGTLIY
RFCAGSFPDRVFPYFNPMGSSEPLTICWPDS
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcttcagaattcgtgatgaatttaaaagaggaggtgacctgtcctatctgcctggac
ctgatggtagaacctgtgagtggagattgtggtcacagcttctgccaagcctgcatcacg
ctgaactatgaatccagcaaatgcaatcaggatgagttcatttgccctgtgtgccgagtt
agttacctgtttaagaacctgaggcccaatcgacatgtggccaacatagtgcagaggctc
aaagagttcaagtccagcccagaagaggagccgaaggtgctttcttgtgcaaggcatgga
gagaaactccagctcttctgtaagaaggacatgatgcccatctgctggctttgtgagcga
tctcaggagcaccgtggacaccaaacagttctcattgaagaggtggtccaggagtataag
gagaagctgcaggcagctctgcaaaagctgatggcagacaagaaagaatttgagaactgg
aaagatgaccttcaaaaggagagaacttactggcagaatcaaatacagaaagatgtggaa
aatgtccagtcagagtttaaaggaatgagagatatcatggactctgaggagaagaaggaa
ttgcagaagctgatgcaagagaaggaagacattatgagcagcctggaagagtctgaaaat
gagtattctcagcagagtaagttgctaggagacctcatcttagatgtggaacatcagtta
caatgctcagccacggaaatgctgcagggtgtagagaacaccataaaacggagtcatact
ttttcgatgaggaagcccaaaaccatccccaaggaacaaagaagagtgttccgagcccct
gatctgcaaggcatgctgcaagtgttacaagaggtcacagaggcccaacgctactgggtt
caagtgacgctggttgaaagcaacaatccaaacattttcattaccgccgacaaaagacag
atacgatatgaagaccaccaagcaagacattttgcccgtccgactgaaaactgtcatgca
ggtgtcctgggatacccagctatccaatcaggaaaacactactgggaagtagatgtgtct
ggaaaaggttcttgggttctgggattaagtgatggaagctacctctttaatccaatattt
cgttcaaatgcagaaagacccccaaacccccccttatttcgtttgaatcttagtaatgat
tcacattctcgtttgagtcttagtaatgattcacattatcaacctaaatatggcttctgg
gttatagggctgtggggaaattctgtgtataatgcttttgaggagtgtacgttcacaggc
aagcccagtgtgttgaccctctctctgatggtccgaccctgtcgtgtcggtattttcctc
gactgtgcagctggcaccctctcgttttacaatatttccaaccatggcactcttatctac
agattctgtgcaggttcctttcctgatagggtttttccatattttaaccccatgggaagt
tcagagccattgacaatatgctggccagactcttaa

DBGET integrated database retrieval system