KEGG   Rattus norvegicus (rat): 308909
Entry
308909            CDS       T01003                                 

Gene name
Smpd1
Definition
(RefSeq) sphingomyelin phosphodiesterase
  KO
K12350  sphingomyelin phosphodiesterase [EC:3.1.4.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
rno04142  Lysosome
rno04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    308909 (Smpd1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    308909 (Smpd1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    308909 (Smpd1)
  09143 Cell growth and death
   04217 Necroptosis
    308909 (Smpd1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     308909 (Smpd1)
SSDB
Motif
Pfam: Metallophos ASMase_C
Other DBs
NCBI-GeneID: 308909
NCBI-ProteinID: NP_001006998
RGD: 1549719
Ensembl: ENSRNOG00000017977
UniProt: Q5XIA6
Position
1
AA seq 627 aa
MPHHGASSGQGHLRAGWEQRLERSLPAPKLGLLWMGLGLALVLALFDSTVLWVPARAYPL
PSQGHSVKFSAVAPQLQNAFGWRNLTCPACKVLFTALNYGLKKEPNVARVGSVAIKMCKM
LNIAPLNVCQSAVHLFEDDVVDVWTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVP
KPPPKPPSPPAPGAPVSRVLFLTDLHWDHDYLEGTDPNCADPLCCRRGSGWPPNSRTGAG
YWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQSRQDQLRALNTITDL
VWKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPWLPADALHTLR
IGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVDELQAAENRGDKVHI
IGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLG
PSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAPGGTPSWKRLYRARET
YGLPDAMPASWHNLVYRMRADEQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARAD
SPALCRHLMPNGSLPDAHSLWSRPLLC
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgccccaccacggagcgtcatccggccagggccatctcagagccggctgggagcagaga
ctggagaggtccttaccggcacccaaattgggactcctttggatggggctgggcttggct
ctggtcctggctctgtttgactccacggttctctgggttcctgccagagcttatcctctt
ccctcccaaggccattctgtcaaattcagtgcggtagcgccgcagctccagaatgccttt
gggtggaggaacctcacctgccccgcctgcaaagtcttatttactgctctcaactatggg
ctgaagaaggagcccaatgtggcacgagtaggctctgtggccatcaagatgtgcaagatg
ctgaacatagcgccactaaatgtgtgccagtcagctgttcatctctttgaggacgatgtg
gtggacgtgtggacacgctcagttctgagcccttcagaagcttgtggcttgcttctgggc
tcctcttgtgggcactgggacatcttttcaacttggaacatctctttgccatcagtgccg
aagccacccccaaagccaccgagcccaccagccccaggtgcccctgtcagccgtgtcctc
ttccttactgaccttcactgggaccatgactacctggagggcacagaccctaactgtgca
gatcccctctgctgccgcagggggtctggatggccgcccaactcacggacaggggctggg
tactggggagagtacagcaagtgtgacctgcccctgcgaacgctagagagcctgttgaaa
gggctgggccccgccggcccttttgaaatggtgtactggacaggagacatccctgcccat
gatgtctggcaacagtctcgacaagatcagctaagggccctgaacaccatcacagacctc
gtgtggaagttcttgggccctgtaccggtgtaccctgctgtgggcaaccatgagagtact
cctgtcaatggcttccctccccccttcataaagggaaaccagtcttcacaatggctttat
gaagccatggccaaggcatgggaaccctggttaccagctgacgcccttcacaccctcaga
attgggggcttctatgccctcaccccacgccctggcctccgcctcatctctctcaatatg
aatttttgttcccgtgagaacttttggctcttgatcaactccacagatcctgctggacaa
ctccagtggctggtggacgagcttcaggctgctgagaatcgaggagacaaagtgcatata
attgggcacattcctccaggacattgcctcaagagctggagttggaactattacaaaatt
atagccaggtatgaaaacactctggctggtcagttctttggccacactcatgtggatgag
tttgagatcttctatgatgaggaaactctgagccgcccactagccgtagccttcctggga
cccagtgctaccacctttatcaaccttaatcctggctaccgagtttaccaaatagatgga
aactacccgggaagctctcatgtggtcctggaccatgagacctacatcctgaatctgacc
caggccaatgcgccggggggcacgcccagctggaagcggctctacagggctcgggaaacc
tatggacttccagatgcgatgcctgcctcctggcacaacctggtctaccgcatgagggct
gatgagcagctcttccagaccttctggtttctctaccataagggccacccaccttcagag
ccctgcggcacaccctgccgcctggccactctgtgtgcccagctctcagcacgtgcagac
agccctgctctgtgtcgccacttgatgcccaatgggagcctcccagatgcccatagcttg
tggtcacggcccctgctgtgctag

DBGET integrated database retrieval system