KEGG   Rattus norvegicus (rat): 308912Help
Entry
308912            CDS       T01003                                 

Gene name
Dchs1, Pcdh16
Definition
(RefSeq) dachsous cadherin-related 1
  KO
K16507  protocadherin-16/23
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    308912 (Dchs1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    308912 (Dchs1)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Cadherin related
   308912 (Dchs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_4
Motif
Other DBs
NCBI-GeneID: 308912
NCBI-ProteinID: NP_001101014
RGD: 1309878
Ensembl: ENSRNOG00000031643
UniProt: D4ACX8
Position
1q32
AA seq 3291 aa AA seqDB search
MQEELSVALSCPGMKSLGTLLPLLVLLGTTVPGIRGQAGSLDLQIDEEQPAGTLIGDISA
GLPPGTAPPPMYFISAQEGSGVGTDLDIDEHSGVVCTARVLDRERRDRYRFTAVTPDGAT
VEVTVRVADINDHAPAFPQARAALQIPEHTALGTRYPLEPAHDADAGRLGTQGYALSGDG
AGETFRLETRPGPGGAPVPELVIAGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLL
DINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPFS
IDAHTGFLKLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMTVIF
LSADGSPRVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCV
ARRLDREERDVYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVA
LPGSFVVRVTARDPDQGTNGQVTYSLAPGTHTHWFSIDPTSGIITTAATLDYELEPQPQL
IVVATDGGLPPLVSSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDAD
SGPFGLLSYSLGAGLGASGSPPFRIDAHSGEVCTTRILDRDQGPSSFDFTVTAIDGGGLK
SMVYVKVFVADENDNPPQFYPREYAASLSAQSTPGTAVLRVHAHDPDQGPHGRLSYHILA
GNSPPLFALDAHSGLLTVAWPLGRRANSVVQLEIGAQDGGGLQAEPIARVNISIVPGTPT
PPIFEQLQYVFSVPEDVAPGTSVGVVQAHNPPGRLGPVTLTLSGGDPRGLFSLDSASGLL
KTLRPLDRELLGPVLELEVRAGSGTPPVFSAARIRVLLDDVNDNSPAFPAPEDTVLLPQN
TAPGTPVYTLRALDPDSGANSRVTFSLLAGGDGLFTVDPTTGHVRLMGPLGPPGGPPHEL
EVEAQDGGSPPRTSHFRLRVVIQDLGIHGLAPRFDSPTYRVDLPSGTTTGTQILQVQAQA
PDGSPVTYHLAADGASNPFGLESQSGWLWVRAALDRESQELYTLKVMAVSGSKAELGQQT
GTATVRVVILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDKDSGPNGRLTYSLQQ
LSEDSKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDAGSPPRSATGTVHVAVLDLND
NSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGSGSELFSL
HPHTGELHTAASLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSTRMVESPDLVEA
DSAATVPVVLTVTAAEGLRPGSLLGSVAPQEPASMGVLTYTLVGGADPEGTFALDSASGR
LYLARVLDFESGPAWRALTVRAEGPGGAGARLMRVQVRVQDENEHAPAFARDPLALALPE
NPEPGATLYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTP
ALLLIVEATDRPANASRRKATRVSARVFVTDENDNAPVFASPSRMRLPEDQPPGPAALHV
VARDPDLGEAARVSYRLAAGGDGHFRLHATTGALSVVRPLDREQRAEHVLTVVASDHGSP
PRSSTQLLTVSVVDVNDEAPAFPQQEYNVILRENSPPGTSLLTLKATDPDLGANGQVTYG
GVSGESFSLDPNSGVLTTLRALDREEQEEINLTVYARDRGLPPLLTHITVRVTVEDENDH
SPTFGNTHLSLEVPEGQDPQTLTTLRASDPDGGLNGQLQYRILGGDPSGAFALDLTSGEF
GTTRPLDREVEPAFQLQIEARDGGQPALSATLLVTVTVLDANDHAPAFPVPSYSVEVPED
APVGTLLLQLQAHDPDEGDNGRVMYYLGAGTAGAFLLEPTSGELSTATALDREHCASYAF
SVTAVDGAAAGPLSTTVPITVTVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLALATLR
AEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPAALGPRDRVLFIVATDLGRPA
RSATGVVIVGIQGEPERGPRFPRANNEAVLRENAPPGTPVISPKAVHSGGSNGPITYSIL
SGNERGIFSIQPSTGTITVQSAEGLDFETNPRLRLVLQAESGGAFAFSVLTLTLQDANDN
APRFLQPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPATG
TITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSE
DALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHL
QLLAHDGPHEGHANLTVLVEDVNDNVPIFSQSLYQVMMLEHTPPGSAILSVSATDRDSGA
NGHISYHLASPAEGFSVDTNNGTLFTTVGAMALGHEGPGVVDVVLEARDHGAPGRSAQAT
VHVQLKDQNDHAPSFTLPHYRVAVSEDLPPGSTLLTLEAIDADGSRSHATVDYSIISGNR
GRVFQLEPRLAEVGDGVGPGPQALGCLVLLEPLDFESLTQYNLTVTAADRGQPPRSSAVP
VTVTVLDVNDNPPVFTRASYRVTVPEDMPVGAELLHVEASDADPGPHGLVHFTLSSGDPL
GLFELDENSGALRLAHPLDCETQAQHQLVVQAADPAGTHFALVPVTVEVQDVNDHGPAFP
LSLLSTSLAENQPPGTLVTTLHAMDGDAGTFGRLRYTLLEAVPGPEGREAFSLNSSTGEL
RARVPFDYEHTGSFRLLVGAADAGNLSASVTVSVLITGEDEYDPVFLAPSFHFQVPEGAQ
RGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTATSGGG
GRTRREAPRELRLEVVARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGAVAASLGV
VVVLALAALVLGLVRARSRKAEAAPGPMSQTAPIASSSLQKLGREPPSPPPSEHLYHQTL
PSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSLAARGPDS
GIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFLGGCGLSP
APTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVFTEIARLK
DEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPASTAATRAIFPPASHRSPISHEGSLSS
AAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSTESGLEPPDDTELRI
NT seq 9876 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggagctaagtgttgcactctcctgccctggcatgaagagcctcgggactctg
ttaccactgctggtgctgttgggaactacagtgccaggaatccggggtcaggctgggagc
ctggacctacagatagatgaggaacaaccagcaggcacactgattggcgacatcagtgca
gggctcccaccaggcacagctcctcctcccatgtactttatctctgcccaggagggcagt
ggcgtaggcacagacctcgatattgatgagcacagtggggtggtctgtacagctcgagtc
ctggaccgtgagcggagagaccgttaccgcttcactgcagtcactcccgatggcgccacc
gttgaagttacggtgagagtagctgatatcaacgaccatgcaccagctttccctcaggct
cgggctgccctgcagatacctgaacatacagctcttggcacacgctacccactggagcct
gctcatgatgcagacgccggacgactaggaacccaagggtatgcgctatctggtgatggg
gctggagagacctttcgactggagacacgtcctggtcctggtggagctccagtgcctgag
ctggtcattgctggggaactggaccgggagaaccgctcacactacatgttgcagctcgag
gcctatgatggtggctcacccccacggagagcccaggccctgctagatgtgacacttctg
gatatcaatgaccatgccccagctttcaatcaaagccgataccatgctgtggtatctgag
agtctggcccctggaagtcctgtcttgcaggtgtttgcatctgatgctgatgctggtgca
aatggggctgtgacttatgagatcaacaggagacagagtgaaggtgatgggcccttctcc
attgatgctcacacagggtttctgaaactggagcgcccactggactttgaacaaaggcga
gttcatgaactggtggtgcaggcaagggatggtggggctcacccagagctgggttcagct
tttgtgacagtgcatgtgcgagatgccaatgacaatcagccctccatgactgtcatcttc
ctgagtgctgatggctccccccgggtgtctgaggctgccccaccgggacaacttgttgct
cgaatctctgtgtcagatccggatgatggtgactttgcccacgtcaatgtgtccctggaa
ggtggagagggccactttgccctgagcacccaagacagtgtcatctatctagtgtgtgtg
gctcgaaggctggatcgggaggagagggatgtctataacttgcgagtcacggccaccgac
tcaggctcaccaccacttcgggctgaagctgcctttgtgctacatgtcactgatgtcaat
gacaacgcacctgcgtttgaccgccagctctaccgacctgagcctctgcctgaagtcgca
ttgcccggcagctttgtggtacgggtgactgcccgggatcctgaccaaggcaccaatggt
caggtcacttacagtctggctcctggcactcacactcactggttctccattgatcctacg
tcaggcatcatcaccacagctgccacattggactatgaactagaacctcagccacagctt
attgtggtggccacagatgggggcctgccccctttagtctcctctgccacagttagtgtg
gccttacaagacgtgaatgacaatgagccccagttccagaggactttctacaatgcctcg
ctgcctgaaggcacccagcccggaacctgtttcctgcaggtaacagccacagatgccgac
agtggcccatttggcctcctctcctattccttgggtgctgggcttggagcttctgggtct
cccccattccgcattgatgcccacagtggtgaggtgtgtaccacccggatcctggaccgt
gaccagggaccttcaagctttgacttcacagtgacagccatcgatgggggaggtctcaag
tccatggtgtacgtgaaggtgtttgtggcagacgagaatgacaacccacctcagttttac
ccacgggagtacgctgccagcctgagtgctcagagcaccccaggcacagctgtgctgagg
gtgcacgcccatgaccctgaccagggaccccatgggcggctttcctaccacatcctggct
ggcaacagcccgccactctttgcattggatgcacactcaggactgctgacagtagcctgg
cccttaggcagacgggctaattctgtggtgcagctggagatcggggctcaggatggaggt
ggtctgcaggcagaacctattgcccgagtcaacatcagcattgtgcctggaacccccaca
ccacctatatttgagcaactacagtatgttttttctgtgccagaggatgtggcaccaggc
accagtgttggcgtagtccaggcacacaacccaccaggtcgcttagggcctgtgaccctc
accctatcaggtggggacccccgagggctcttctccctagattcagcctcggggctatta
aaaacacttcgtcctctggaccgggagcttctgggacctgtcctagagctagaggttcga
gcaggcagcggaacccccccagttttctctgctgctcggatccgtgtgcttctggatgat
gtgaacgataactctcctgccttccctgcacctgaagacactgtgttgttgccacaaaac
actgctccagggactcctgtctatacactgcgtgctctagatcccgactcgggagctaac
agtcgagtcacctttagtctacttgctggaggtgatggattgttcactgtggaccctacc
acgggccacgtccggctcatgggacctctagggcctccagggggaccaccccatgagttg
gaagtggaggcccaggatggaggctccccaccacgcaccagccactttcgacttcgtgtg
gtgatacaggatttgggaatccatgggttggctccacgatttgacagccctacctaccga
gtggacttgccttcaggcactaccactggaactcagatcttgcaagtgcaggcccaggca
ccagatgggagccccgtcacttaccatcttgcagcagatggagccagtaacccctttggc
ctggagtcacagagtgggtggctgtgggtacgggcagcattagaccgtgagtcccaggag
ttatacacattgaaggtgatggctgtatctggttccaaagctgaattggggcaacagaca
ggcacagccacagtgagggtcgttatcctcaaccaaaatgaccacagtccccgcttgtct
gaagagcccacctttctggctgtagcagagaaccaacccccagggaccagtgtaggccga
gtctttgccactgacaaagactcaggtcctaatgggcgtctgacctacagccttcaacag
ctttcagaagacagcaaggccttccgcatccacccccagactggagaagtgactacactc
caaaccctggaccgagagcaacagagcagcttccagctcctggtccaggtgcaggatgcg
ggcagtccacctcgcagcgccacaggcactgtgcatgtcgcggtgcttgacctcaacgac
aacagtcctaccttcctgcaggcttcaggggctgctggtggaggtctccctatccaggta
ccagaccgagtgcctccaggaacactggtgacaactctgcaggccaaagatccagatgag
ggggagaatgggaccatcctatacaccctaactggttctggctctgagctcttctctctg
catcctcacacgggggagctgcacactgcggcatctctgattagagctgagaggcctcac
tatgtgctaactcttagcgctcacgaccagggcagcccccctcgaagtgccagcctccaa
ctgctcgtacaggtgcttccctcgactcgtatggtggagtcaccagatctcgtagaagct
gactcagcggcaacagtgcctgtagtactgacagttacagcagctgaggggcttcgacct
ggatccctgttaggttcggtggccccgcaggagccagctagtatgggcgtactcacctat
actctggttggtggagccgaccccgagggcaccttcgctctggactcagcctcaggtcgc
ctgtacttggcccgtgtcttggactttgagtctgggccggcttggcgcgcgctcacggtg
cgcgccgaggggccgggaggtgcaggagcgcggctgatgagagtgcaggtgcgcgtgcaa
gacgagaacgagcacgcgcccgcttttgcacgcgaccccctggcactggcgctacctgag
aaccctgagcccggcgccacgctgtatactttccgtgcttcagacgcggatggcccaggt
cccaacagtgacgtgcgataccgcctgctgaggcaggaacccccggttcccgccctgcgc
ttggacgcgcgcaccggggcgctcagcgctcctcgtggtctggatcgggagaccacaccc
gcgctgttgctgatcgtggaagccacagacagaccagccaatgccagccgccgcaaggca
acgcgcgtctcggcgcgggtctttgtcacggatgaaaatgacaacgcccctgtcttcgcc
tcaccatcacggatgcgcctcccagaggatcagcctcctgggcctgcggcgctgcacgtg
gtagctcgggatccagatctgggggaggctgcccgtgtgtcctatcgtcttgcggctgga
ggggatggccacttccggctacatgcgaccactggagcgctgtccgtggtgcggcccttg
gaccgtgaacagcgagctgagcatgtactgacagtggtggcctcggaccatggctcgccg
ccacgttcatccactcagctcctgactgtcagtgttgttgacgtcaacgacgaggcaccc
gctttccctcagcaggagtacaacgtcatccttcgtgagaacagtccgcctggcacttct
ctgctcacactgaaggcaactgaccctgaccttggggccaatgggcaagtgacttatggg
ggtgtctctggcgagagcttctctctggacccaaacagtggagttcttacgactctgagg
gctctggaccgggaggagcaggaggagatcaatttgacagtatatgcccgggacaggggc
ttgccacccctgttaactcacatcacagtgcgagtgactgtggaagatgagaatgaccat
agtccaacttttgggaacacccatctctccctggaagtgccagaaggccaggacccccaa
acccttaccacactacgagcctctgatccggatgggggactcaacggacagctccagtac
cgcatccttggtggggacccttcaggagcctttgcactagatctcacttctggggagttt
ggcaccacgaggccactagaccgggaggtagagcctgcattccagctgcagatagaggcc
agagatggaggccagccagcccttagtgcgaccttgcttgtgacagtgacagtgctggat
gccaatgaccatgcgccagcctttcctgtgccttcttattctgtagaggtacctgaggat
gcacctgtcgggaccctactgctgcaactacaggctcatgacccggatgagggggacaat
ggccgtgtgatgtactacctgggtgcaggtacagcaggggccttcctgctggagcctacc
tctggggaactgagcacagccacagccttggacagagagcactgtgccagctacgccttt
tctgtgactgcagtggatggtgcagctgctgggcctctgagcactacagtaccaatcacc
gtcacggtgcgtgatgtcaatgatcacgcacccgctttccccaccagtcctctgcgcctc
cgcctaccccgcccaggtcctagcctcaacaaaccaaccctggctctggccacgcttcga
gctgaagatcgagatgctggtgccaatgcctccattctataccggctggcaggcacacca
ccacctggcaccactgtggactcttacactggtgaaatccgtgtggctcgatcccctgcg
gctcttggacctcgggatcgtgtcctcttcatcgtggctactgaccttggccgcccagct
cgctctgccactggtgtggtcattgttgggatacaaggagagcctgagcgtggaccccgc
tttcccagagctaataatgaggctgtgctccgtgaaaatgcaccaccagggactccagtt
atctccccaaaggctgtccattcaggaggctcaaatggaccaattacctatagcattctc
agtgggaatgagagagggattttctccatccaacctagcacaggaaccatcacagttcag
tcagcagaggggcttgactttgagacaaacccacggctacgactggtgctacaggcagag
agtggaggagcctttgctttctcggtgctgaccctgacccttcaagatgccaatgacaat
gctccccgtttcctgcagcctcactacgtggctttcctgccagagtcccgacccttggaa
gggcccctgctgcaggtggaagcagacgacctggatcaaggctctggaggacagatctcc
tacagtctggctgcatcccagccagcacggggcttgttccatgtagacccagccacaggc
actatcactaccacagccatcctggaccgggaaatctgggctgaaacacggctggtactg
atggccacagacagaggaagcccagcattggtgggctcagctaccctgacagtgatggtc
atcgataccaatgacaatcgccccaccatcccccagccctgggagctccgcgtgtcagaa
gatgcactgctgggctcagagatcgcacaggtgactgggaatgatgtggattctggacca
gtgctatggtatgtgctgagcccatctggaccccaggatcccttcagtattggccgatat
ggaggacgtgtctccctcacgggccccctggactttgagcaatgtgaccactaccaccta
cagctgctggcacatgatgggcctcatgagggccatgccaacctcacagtgcttgtggaa
gatgtcaatgacaatgtacccatcttctcacagagcctctaccaggtaatgatgttagag
cacacccctcctggcagcgccattctctccgtctctgccactgacagagactcaggtgcc
aatggtcacatatcctaccatctggcttcccctgctgagggcttcagtgtcgacactaac
aatggaactctgttcacaacagtgggagcaatggccttgggccatgaggggccaggagtg
gtagatgtggtgctggaagcacgagaccatggggctccaggccggtcagcacaggccacg
gtgcatgtgcagctgaaagaccagaatgaccatgccccaagcttcacgttgccacactac
cgtgttgctgtgtctgaagatttaccccctggttccaccctgctcaccctggaggccata
gatgctgatggaagccgcagccatgctactgtagactacagcattatcagtggcaatcgg
ggccgagttttccagctggaaccccgcctggctgaggttggggacggtgttgggccaggt
ccccaggctttgggctgcctagtgttgcttgagcctctagactttgaaagcctgacacag
tacaatttaactgtgaccgcagctgaccggggacagccaccccgcagttcagccgtgccc
gtgactgtcactgtactggatgtcaatgacaacccacctgtctttactcgagcatcctac
cgtgtgacagtacctgaggacatgcctgttggagctgagctattgcatgtggaggcctct
gatgctgaccctggacctcatggccttgtgcatttcacccttagctcgggtgatccttta
ggcctctttgagctggatgagaactcgggtgctctgaggctggcccaccctctggactgc
gaaacccaggctcaacatcagcttgtggtgcaggcagctgaccctgctggaacacacttt
gctctggtaccggtgacagttgaggtccaggatgtgaatgaccatggtccagccttccca
ttgagcctgctcagtactagccttgctgagaatcagcctccaggcactcttgtgaccacg
ctacatgcaatggatggggatgctgggacttttggtagactccgatacacactgttggag
gcagtgccagggcccgagggtcgtgaggcattctcactgaacagctcaacaggggaattg
cgggcacgggtaccttttgactatgagcacacaggaagcttccgtctactagtgggcgct
gctgatgctgggaatctctcggcttctgtcaccgtgtcggtgctgatcactggagaagat
gaatatgaccctgtattcctggctccatctttccatttccaagtgcctgaaggtgcccag
cgtggccacagcctgggccatgtgcaggccacagatgaggacggaggtgctgatggtctg
gtgctctattcgctggctacctcttccccctattttggtatcaaccagacaacaggtgct
ttgtacttgcgagtggacagtcgggcaccaggaagtggaacagccacctctgggggtggg
ggccggacccgacgtgaagcaccgcgggagttaaggctggaggtagtagcgagagggcct
ctgcctggatcgcggagtgccacagtgcctgtgactgtggatattacccacactgctcta
ggcctggcacctgacctcaacttgctattggttggggctgtggcagcttctttgggagtt
gtggtggtgctggccctggcagctcttgtcctgggccttgttcgggcacggagccgcaag
gctgaggcagcccctggcccaatgtcacagacagcacccatagccagtagctctttacag
aaactgggtcgggaaccccccagtccaccaccctctgaacacctgtatcatcagactctt
cccagctatggtgggccaggagctggaggtccctacccccgtggtggctccttggaccct
tcacattcaagtggccgaggctcagcagaggctgcagaggatgatgagatacgcatgatc
aacgagtttccccgtgtggccagtgtggcctcctccctggccgcccgaggccctgactcg
ggcatccagcaggatgcagatggactgagtgacacgtcttgcgagcctcctgcccctgac
acctggtacaagggcaggaaggcagggctgctgctgccaggcgcaggagccactctgtac
cgagaggaggggcctccagccactgctacagccttcctggggggctgtggcctgagccct
gcacccactggggactatggcttcccagcagatgggaagccatgtgtagctggagcgctg
acggccatcgtggctggtgaggaagagctccgtggcagctataactgggactacctgttg
agctggtgccctcagttccagcctctggccagtgtcttcacagagattgctcggctcaag
gatgaagcccgtccatgtcctcccgctccccgtattgacccaccacccctcatcactgct
gtggcccacccaggagccaagtctgttcccccaaagcctgcaagcacggctgccacccgg
gccatcttcccaccagcctctcaccgctcccctatcagccatgaaggctccctctcctca
gctgccatgtcccccagcttctcaccctcactgtctcctttggctgctcgctctcctgtt
gtctcaccattcggggtagcccagggcccctcagcttcagcactcagcacagagtctggc
ctggagcctcccgatgacacagagctgcgcatctag

DBGET integrated database retrieval system