KEGG   Rattus norvegicus (rat): 308968Help
Entry
308968            CDS       T01003                                 

Gene name
Rbbp6
Definition
(RefSeq) RB binding protein 6, ubiquitin ligase
  KO
K10624  E3 ubiquitin-protein ligase RBBP6 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    308968 (Rbbp6)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     308968 (Rbbp6)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  U-box type E3
   308968 (Rbbp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DWNN zf-CCHC_2 U-box zf-CCHC zf-C3HC4_2 zf-C3HC4_3 zf-RING_5 zf-RING_2 zf-C3HC4_4 zf-RING_UBOX zf-C3HC4
Motif
Other DBs
NCBI-GeneID: 308968
NCBI-ProteinID: XP_001076339
RGD: 1311964
Ensembl: ENSRNOG00000012806
UniProt: G3V953
Position
1q36
AA seq 1789 aa AA seqDB search
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADSDLQITNAQTKEEYTDD
NALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPVMGTTKAIDDSSASISLAQLTKTANL
AEANASEEDKIKAMMSQSGHEYDPINYMKKTLVGPPPPSYTCFRCGKPGHYIKNCPTNGD
KNFESGPRIKKSTGIPRSFMMEVKDPNMKGAMLTNTGKYAIPTIDAEAYAIGKKEKPPFL
PEEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTC
HQNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQLPPPPPPISAPRPLIQRNLQPLMR
SPISRQQDPLMIPVTSSSAHSTPSISSLTSNPSSLAPSVPGNPSSAPAPVPDITATVSIS
VHSEKSDGPFRDSDNKLLPAAALASEHSKGASSIAITALMEEKGYQVPVLGTPSLLGQSL
LHGQLIPTTGPVRINAARPGGGRPGWEHSNKLGYLVSPPQQIRRGERSCYRSINRGRHHS
ERSQRTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYSV
PPPGFPPAPANISTPWVSSGVQTAHSNTIPTTQAPPLSREEFYREQRRLKEEEKKKSKLD
EFTNDFAKELMEYKKIQKERRRSFSRSKSPYSGSSYSRSSYTYSKSRSGSTRSRSYSRSF
SRSHSRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQ
SPTKRNVPQGETEREYFNRYREVPPPYDIKAYYGRSVDFRDPFEKERYREWERKYREWYE
KYYKGYAVGAQPRPSANREDFSPERLLPLNIRNSPFTRGRREDYVAGQSHRNRNLGGNYP
EKISTRDSHNPKDNPKSKEKESENVPGDGKGNKHKKHRKRRKGEESESFLNPELLETSRK
SRESSGIDETKTDALFVLPSRDDATPVRDEPMDAESITFKSVSEKDKREKDKPKVKSDKT
KRKSDGSATAKKENVLKPSKGPQDKVDGDREKSPRSEPPLKKAKEEATKVDSVKPSSSQK
DEKVTGTPRKAHSKSAKEHQEAKPVKEEKAKKDCSKDIKSEKPASKDEKAKKPEKNKLLE
SKGEKRKRKTEEKSVDFESSSMKISKVEGTEIVKPSPKRKMEGDVEKLERTPEKDKSASS
TTPAKKIKLNRETGKKIGNAENPSTTKEPSEKLESTSNKIKQEKVKGKARRKVAGTEGPS
STLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSKWD
KDDFESEEEDDVRTTQPIQSVGKPSSIIKNVTTKPSATVKCTEKENEQSEKIQKLTKEVS
HEVIQHELRSSKGSVSSEKGRAKDRDHSASEKDNPDKRKTSIQPDKESTVDRLSEQGHFK
NLSQSSKETRTSEKHESVRGSSNKDFTPGRDKKTDYDSRDYSSSKRRDERSELTRRKDSP
PRSKDSLSGQKSKLREEKDLPKKGTELKKSNSSPPRDKKPHDHKASYETKRSCEETKSVD
KNAGKEREKHAAEASRNGKESSGSKLPSIPNPPDPPMEKELAAGQIEKSTIKPKPQLSHS
SRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEEAVASVSKDLKEKATEKATESLNVAT
ASQPGADRSQSQSSPSVSPSRSHSPSGSQTRSHSSSASSAESQDSKKKKKKKDKKKHKKH
KKHKKHKKHAGVDGDVEKSQKHKHKKKKAKKNKDKEKEKDDQKVKSVTV
NT seq 5370 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgtgtgcactataaattttcctctaaactcaactacgacaccgtcacctttgat
gggctccatatctccctctgcgacttaaagaagcagattatggggagagaaaagctgaaa
gctgccgatagcgatctgcagatcaccaacgcgcagacgaaagaagaatatactgatgat
aatgcactcattcctaaaaattcatctgtaattgtcagaagaattcctattggaggtgtt
aagtctacaagcaagacatatgttataagtcgaactgaaccagtgatgggaactacaaaa
gcaattgatgactcttctgcgtctatttctctggcccagcttacaaagactgccaatctg
gctgaagccaatgcttctgaggaagacaaaattaaagcaatgatgtcgcaatctggccat
gaatacgacccaatcaattacatgaagaaaactctagtaggcccgccacctccgtcttat
acctgttttcgttgtggtaaacctggtcattatattaagaattgcccaacaaacggggat
aagaactttgaatctggtcctaggatcaaaaagagcactggaattcctagaagttttatg
atggaagtgaaagatcctaacatgaaaggcgcaatgcttacgaacactggaaaatacgca
ataccgactatagacgcagaggcctatgcaattgggaagaaagagaaaccacccttctta
ccagaggagccatcgtcatcttcagaagaagatgatcctatcccagatgagctcttgtgc
ctcatctgcaaagacattatgactgatgccgttgtcattccctgctgtggaaacagttac
tgtgatgagtgtataaggacagcactcctggagtcagatgagcatacatgtccaacatgt
catcaaaatgatgtttctcctgatgctttaattgccaacaagtttttacgacaggctgtt
aataacttcaaaaatgaaactggctatacaaaaagactacgaaaacagttacctccaccc
ccacctccaatatcagcgccaagaccactcattcagcggaacctgcaacctctgatgaga
tctcccatatcaagacagcaggatcctctgatgattccagtgacatcttcctcagctcac
tcaactccctctatatcttcattaacttcaaatccatcctccttggctccttccgtgcct
ggcaacccatcttctgccccagctccagtgcctgatataactgcaacagtatctatatca
gtccactcagaaaaatccgatgggccttttcgggattctgataataaactattaccagct
gccgcccttgcatcagaacactcaaagggagcgtcctcaattgctattactgctcttatg
gaagaaaagggttaccaggtgccagtccttgggactccatctttgttgggacagtcatta
ttgcatggacagttaatacccacaactggtccagtaagaataaatgctgctcgtccaggt
ggtggtcgaccaggttgggaacattccaacaaacttgggtacctggtttccccaccacag
caaattagaagaggagaaagaagctgttacagaagtataaaccgcgggcgacaccacagc
gaacgatcacagaggactcaaggcccatcactaccagcaactccagtctttgtgcctgtc
ccaccacctcctttgtatccacctcctccccatacacttcctcttcctccaggtgtacct
cccccacagttttctcctcagtttcctcctggccagcctccaccagcaggatatagtgtc
cctcctccagggttcccgccagctcctgccaatatatcaacaccttgggtatcatcagga
gtgcagactgcccattcaaataccatccctacaacacaagcacctcctttgtccagggaa
gaattctatagagagcagcgacgactaaaggaagaggaaaagaaaaagtccaagctagat
gagtttacaaatgattttgctaaggaattgatggaatacaaaaagattcaaaaggagcgt
aggcgctcattttccaggtctaaatctccctatagtgggtcatcgtattcaagaagttca
tacacttactcaaagtcaaggtctggctcaacacgttcacgctcttactctcggtccttc
agccgctcacactctcgctcctattcacggtcacccccataccccaggagaggcagaggc
aagagccgcaattaccgttcacggtccagatctcatggataccatcgatctaggtcaagg
tcacctccctatagacgataccactcacggtcgagatctcctcaagcatttaggggacag
tctcccactaaacgcaatgtacctcaaggagaaacagagcgtgagtattttaatagatac
agagaagttccacccccttatgatatcaaagcctattatgggcggagtgtcgactttaga
gacccatttgagaaagaacgctaccgggaatgggagaggaaataccgagagtggtatgag
aagtactacaaagggtacgcagtgggagcccagcctagaccctcagccaacagagaggac
ttttctccagagagactcttacctcttaatatcagaaattcaccctttacaagagggcgc
agagaagactatgttgctggacaaagtcatagaaatagaaatctaggtggcaactatcca
gaaaagatttcgacaagagatagtcacaatccaaaagataatccaaagtcgaaagagaag
gagagtgaaaatgttccaggagacggcaaaggaaacaagcataagaaacacaggaaacga
agaaagggggaagagagtgagagcttcctgaacccagagctactggaaacttctagaaaa
tccagggaatcctcagggatcgatgaaacaaagacagatgcactgtttgttctcccaagc
agagacgatgctacacctgttagggatgaaccaatggatgcagaatctatcaccttcaaa
tcagtatctgaaaaagacaagagagaaaaggataaaccaaaagtaaaaagtgacaagacc
aaacggaaaagtgatgggtctgctacagccaagaaagaaaatgttttaaaaccttctaaa
ggaccccaagacaaggtagatggagaccgtgaaaaatctcctcggtctgaacctcctctc
aaaaaagccaaagaggaggctacaaaggtcgactctgtaaaaccttcctcatctcagaag
gatgagaaggtcactggaacccctagaaaagcccactccaaatctgcaaaagaacaccag
gaggcaaagccagtcaaagaggagaaggcaaaaaaggactgttccaaagacatcaagtca
gaaaagccagccagtaaggacgagaaggccaagaagcctgagaaaaataaactacttgaa
agcaagggagagaaacgaaagagaaaaaccgaagagaagagtgtagattttgagtcctct
tcaatgaaaatctctaaagtggaaggaacagaaatagtgaaaccatcaccaaagcggaaa
atggaaggtgatgttgaaaagctggaaaggaccccagaaaaggacaagagtgcatcatca
actaccccagccaaaaaaattaaactcaatagagaaactggaaaaaaaattggaaatgca
gaaaatccatctactacaaaagaaccctctgaaaaactggagtcaacatctaacaaaatc
aaacaggaaaaagtcaagggaaaggccagacggaaagtagctgggacagaaggccccagc
tccacgcttgtggactacaccagtacaagctcaactggaggcagtcctgtgaggaaatct
gaagaaaagacagatacaaagagaacagtcattaaaactatggaggaatataataatgat
aatacagcgcctgcagaagatgttataattatgattcaggttcctcagtccaaatgggat
aaagatgactttgaatctgaagaagaagatgatgttagaaccacacagcctatacagagt
gtagggaaaccatccagtattataaaaaatgtcactactaagccatcagctacagttaag
tgcactgagaaagaaaatgagcagtctgagaaaattcagaagcttaccaaggaggtcagc
catgaggtgatacagcatgagctcaggagctcaaagggctctgtgtccagtgagaagggg
agagccaaggaccgggatcactcagcgtcagagaaggacaaccctgacaagaggaagacc
agtatccagccagacaaggagagcactgtggaccgcctgagtgagcaaggacattttaag
aatctctctcagtcttccaaagagaccaggacttcagagaagcatgagtctgttcgtggc
tcctcaaataaagacttcactcctggtagagacaagaaaacggactacgacagcagagat
tattccagttccaaacgaagagacgaaagaagtgaattaacaagaagaaaagactctcct
cctcggagtaaagattctttatctggacagaaaagtaagctgagggaggagaaagattta
cctaaaaaggggacagagttaaaaaaaagtaattctagtcccccaagagacaaaaagcct
catgatcataaagcctcctatgaaaccaaacgctcatgtgaagagacaaagtctgtagat
aaaaatgctgggaaggaacgggagaagcatgctgctgaagcttctcgaaacgggaaagag
tccagtggcagcaagttgccatctatacccaacccgcctgaccctcccatggaaaaggag
ctggctgccgggcagattgagaagagcaccatcaagccaaaaccccagttgagtcattcc
tcaaggctttcctctgatctcactagagagactgatgaggctgcttttgaacccgactat
aacgagagcgatagtgagagtaatgtgtctgtgaaggaggaagaagctgttgccagtgtc
tccaaggacttgaaagagaaagcaacagagaaagcaacagagagcttgaatgtagcaaca
gccagccagccaggtgcagacaggagccagagccaaagtagccccagtgttagtccaagt
agaagtcatagcccttccggcagccagacccggagccacagcagcagtgccagctcggca
gaaagccaagacagcaaaaagaagaaaaagaagaaagacaagaaaaagcacaagaagcat
aaaaagcacaagaagcacaagaagcatgcaggcgtggacggtgatgtggagaagagccag
aaacataaacacaagaagaagaaggcgaagaaaaacaaagacaaggagaaggagaaagat
gaccaaaaagtgaaatctgtcactgtgtga

DBGET integrated database retrieval system