KEGG   Rattus norvegicus (rat): 308976Help
Entry
308976            CDS       T01003                                 

Gene name
Kdm8, Jmjd5, RGD1304823
Definition
(RefSeq) lysine demethylase 8
  KO
K10277  lysine-specific demethylase 8 [EC:1.14.11.27]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     308976 (Kdm8)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    308976 (Kdm8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 Cupin_4 JmjC Cupin_2
Motif
Other DBs
NCBI-GeneID: 308976
NCBI-ProteinID: NP_001032273
RGD: 1304823
Ensembl: ENSRNOG00000015180
UniProt: Q497B8
Position
1q36
AA seq 414 aa AA seqDB search
MSEDTTEPLVGPSTLWKDLRALLPDTEEELKLDLSEKVDRSMATLLRQALGLFYEGRWQK
CLQASEAVLDYSWEKLNTGPWRDVDKEWRRVYSFGCLLKTLCLCQAPQKATAVAEALRVC
DMGLLMGAAILGDILLKVATVLQTHLLPRKQPACGPHQDQPATKKAKHDASSTPDVVLDR
EVPRLRCPPLQHFKKHFLVPGRPVILEGVADHWPCMKKWSLQYIQEIAGCRTVPVEVGSR
YTDEDWSQTLMTVNEFIHKYILSEAKDVGYLAQHQLFDQIPELKQDISIPDYCCLGNGEE
EEITINAWFGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHILHNTSQ
VDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFWWS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggacactacagagcccctagtggggcccagcaccctctggaaggacctcagg
gcgctcctgccagacacagaggaggagctgaagctggatctcagtgagaaggtggacagg
agcatggctacgctgctacggcaggctttgggtctgttctatgaaggccgttggcagaag
tgcctgcaggccagtgaggctgtcctggactactcctgggaaaagctcaacactggtccc
tggcgagatgtagacaaggaatggcgccgggtatattccttcggctgcctcctgaagacc
ctgtgcctgtgccaggcaccacagaaggccactgctgtggctgaagcactgcgggtgtgt
gacatgggcctgttgatgggggcagccatccttggggacattcttctcaaagttgctaca
gtcctccagacacatctgctccctagaaagcagcctgcctgtggccctcaccaggatcag
cctgctaccaagaaggcaaagcatgatgccagctcaactcctgatgtggtattagatcgg
gaagtgcccaggcttcgctgcccacctctgcagcacttcaagaagcattttctagttcct
gggagacctgtgatcttggaaggtgtggctgaccactggccgtgcatgaagaagtggagt
ctacagtacatccaggagattgctggctgccgcactgtccccgtggaagtgggttcaaga
tacacagatgaagactggtcccagactctcatgacagtcaatgagttcatccacaaatac
attctgagcgaggcaaaggatgtcgggtaccttgctcaacaccagctgttcgaccagatc
ccagagttgaagcaggacatcagcatccccgattactgttgcctgggcaatggagaagag
gaagagatcactatcaatgcctggtttggtcctcaaggaaccatctccccattgcatcag
gacccccagcagaacttcctggtccaggtgttaggaaggaagtacatccggctgtattct
ccgcaagagtctgaggcagtgtaccctcatgagacacacattcttcataacaccagccag
gttgatgtggaaaaccccgacctagagaagttccccaagttcaccgaggccccgtttctg
tcctgcattctgtccccaggagacaccctctttatacctgctaagtactggcattacgtg
cgctccctggacctgagcttctctgtcagcttctggtggtcatag

DBGET integrated database retrieval system