KEGG   Rattus norvegicus (rat): 308977Help
Entry
308977            CDS       T01003                                 

Gene name
Il21r
Definition
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  Jak-STAT signaling pathway
rno04659  Th17 cell differentiation
rno05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    308977 (Il21r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    308977 (Il21r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    308977 (Il21r)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    308977 (Il21r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    308977 (Il21r)
   04090 CD molecules [BR:rno04090]
    308977 (Il21r)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL2 receptor family
   308977 (Il21r)
CD molecules [BR:rno04090]
 Proteins
  308977 (Il21r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4Ra_N
Motif
Other DBs
NCBI-GeneID: 308977
NCBI-ProteinID: NP_001012487
RGD: 1304950
Ensembl: ENSRNOG00000015773
UniProt: Q5EBB1
Position
1q36
AA seq 521 aa AA seqDB search
MPRGLAAPLLLLILHGGWSCLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQD
KETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKP
APPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDS
RNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDPHVLL
LLAVLILVLVFMGLKNHLPWRLCKKIWAPVPTPESFFQPLYREHSGNFKKWVNTPFTASS
VELGPQSPTTSVLHLSLYPAKGKKFLGPLGLEEQLECDGMSGPGHKCQGVSAYSEERDRP
YGLVSIDTVTVGDAEGLGAWPFSCEDDGYPALNLDAVRESGPNGEDLLLVTDPAFLSCGC
VSGSGLRLGGSPGSLLDRLRLSFAKEGDWTAGPPWRTGSLEGGSESEAGSPPGLDMDTFD
SGFAGSDCGSPVETDEGPPRSYLRQWVVRTPPPVDSGAQNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgccacggggcctggctgctcccttactcctactgattctccatggaggttggagctgc
ctggacctcacctgctacactgactacctctggaccatcacctgtgtcctggagacatgg
agccccaaccctagcatactcagtctcacctggcaagatgaatacgaggaacttcaggac
aaagaaacatcctgcagcctgcacgcgtctggccacaacaccacacatatgtggtacacg
tgccatatgcgcttgtctcaattcatgtctgatgacgttttcactgtcaacatgatggac
cagtctagcaacagctcccaagagtgtggcagctttgtcctggctgagagcatcaagcca
gctccccccttgaatgtgactgtgaccttctcaggacgatatgatatctcctgggactca
atttatgaagaaccctccaactacgtgctgaggggcaagctacaatatgagctgcagtat
cggaacctcagagacccctatgctgtgaggccggtgaccaagctgatctcagtggactcg
agaaacatctctcttctccctcaagagttccagaaagattctagctaccagctgcaggtg
cgggcagcacctcagccaggcacttcattcagggggacctggagtgagtggagtgacccc
atcatctttcagacccaggctgaggagcccgaggcaggctgggaccctcacgtactgctg
ctcctggctgtcttgatccttgttctggttttcatgggtctgaagaaccatctgccttgg
aggctatgcaagaagatatgggcaccggtgcccacccccgagagtttcttccagcccctg
tacagggagcacagcgggaacttcaagaaatgggttaatacccctttcacggcctccagc
gtggagctggggccacagagtcccacaacatcagttttacatctgtcattgtatccagcc
aaggggaagaagttcctggggccgctgggtctggaagaacagctggagtgtgatggaatg
tctggacctggtcacaagtgccaaggggtctcagcctacagtgaggagagagaccggcca
tatggtctggtgtccattgacacagtgaccgtgggggatgcagagggcctgggtgcttgg
ccctttagctgtgaagatgatggctacccagccctgaacctggatgctgtccgagagtct
ggccctaacggagaggacctgctcttggtcacagaccctgcttttctgtcttgtggctgt
gtctcagggagtggactcaggctaggaggctccccaggcagcctactggacaggttgagg
ctgtcatttgccaaggaaggggactggacagcaggcccaccctggagaactgggtcccta
gaaggaggctctgagagtgaagcaggttcaccccctggtctggacatggacacatttgac
agcggctttgcaggttcagactgcggcagccctgtggagactgatgaaggaccccctcga
agctatctccgccagtgggtggtcaggactcctccacctgtggacagtggagcccagaac
agctag

DBGET integrated database retrieval system