KEGG   Rattus norvegicus (rat): 308988Help
Entry
308988            CDS       T01003                                 

Gene name
Sez6l2, RGD1565281
Definition
(RefSeq) seizure related 6 homolog like 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi CUB
Motif
Other DBs
NCBI-GeneID: 308988
NCBI-ProteinID: NP_001101020
RGD: 1565281
Ensembl: ENSRNOG00000027098
UniProt: D4A6P1
Position
1q37
AA seq 923 aa AA seqDB search
MGTPKAQHPPPSQLLFLILLSCAWIEGLPLKEDEMMPEPGSETPTVASEDLAELLHGALL
RKGPEIGFLPGSDPDPTLATPPAGQTLAAPSLPRATEPGTGPLTTAVTPKGVRGSGPTAP
ELLTPPPGTTAPPPPGPASPVPPLRPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGFVESPDLGSTASRSVELLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGNGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPAWTGEPPSCTASCGGTIHNATLGR
IVSPEPGGAAGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFPPFLAHGNVTTTDPE
YRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTASD
AGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVAYEELLDNRK
LEVTQTTDPSRQLEGGNLALAILLPLGLVIVLGTGVYIYYTKLQGKSLFGFSGSHSYSPI
TVESDFSNPLYEAGDTREYEVSI
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggggactcccaaggcccagcacccgccgccttcccagctgttgttcctaattctgctg
agctgtgcctggattgagggtttgcccctgaaggaggatgagatgatgccagagcctgga
agtgagactcccacagtggcctctgaggacctggctgagctgctccatggggctttgctg
cggaagggcccagagatcggcttcttgccgggatctgacccagaccccacactagccacc
cctccagccggccagactcttgcagcaccctccctgccacgtgccactgagccggggaca
gggcctctgacgacagctgtcacccctaaaggggtcagagggtcaggccccaccgcacca
gagctgctgaccccaccccctggaactacagccccgcccccacctggccccgcctccccg
gtcccacccctcaggcccgagggaggagaggaagaaaccaccaccaccatcatcaccaca
acaactgttaccactactgtcaccagcccagttctgtgcaataacaacatctccgagggc
gaagggtttgtggaatctccagacttggggagcactgccagccgctctgtggagctccta
gattgcacctacagcatccacgtctaccctggttatggcattgagattcaggtgcagaca
ctcaacctctctcaggaggaggagctcctggtgctggctggtgggggctctccaggcctg
gcccccagactcctggctaattcctccatgctgggagaaggacaagtgcttcggagtcca
acaaaccggctgctcctgcatttccagagtcctcgagtcccaaggggcaatggcttcagg
attcactatcaggcataccttctgagctgtggcttcccaccccggccagcccatggggac
gtgagtgtgacagacttgcatcctgggggcaccgccaccttccactgtgactcaggatac
cagctgcagggtgaggagaccctcatctgcctcaatggcacccggccagcctggactggt
gaaccccctagctgcacagcatcttgtggtggtaccatccacaatgccacactgggtcgc
attgtgtcccctgagcctgggggagctgcagggcccaacctcacctgtcgctgggtcatc
gaagcagctgagggacggcggctacacctgcactttgagagagtctcactggatgaggac
aatgaccggctgatggtgcgctcagggggaagccccctgtcccctgtgatttatgactct
gacatggatgatgtccccgagcgtggcctcatcagtgacgcccagtccctctacgtagaa
ctgctttcagagacgccagccaaccccctgctgctcagcctccggtttgaagcctttgag
gaggatcgctgcttcccgcctttcctggcacatggcaatgtgaccaccacagatcctgag
taccgcccaggggcactggccaccttctcatgcctcccaggatatgctctggagccacca
gggccccccaatgctattgaatgtgtggatcccactgaaccccactggaatgacacagag
ccagcctgcaaggccatgtgtggaggagagctgtctgagccagctggtgtggtactctct
cccgactggccccagagttacagtcctggccaagactgcgtgtggggcctgcacgtccag
gaagagaagcgcatcttgctccaagttgaaatcttgaatgttcgcgaaggggatatgcta
acactgttcgacggtgatggcccgagcgctcgagtcctggcccagctgcgggggcctcag
ccacgccgccgcctcctctcctctggacctgatctcactctgcagtttcaggcaccccct
gggcctccaaatccgggcctaggccagggtttcgtgttacacttcaaagaggtcccgcgg
aacgatacgtgcccggaactgccacctcctgagtggggctggaggacagcatcccacggg
gaccttatccggggcaccgtgctcacttaccaatgcgagcctggctacgaactactggga
tcagacatcctcacttgccaatgggacctgtcctggagcgcggcgccacctgcctgccaa
aagatcatgacttgtgctgaccctggtgagatcactaatggccaccggactgcctcagat
gctggttttcctgtgggctcccatgtccagtatcgatgtctgccaggatacagcctagag
ggggcagctgtgctcacctgctacagccgggacacgggcacacccaagtggagcgatcgg
gtccccaaatgcgccttaaagtacgagccatgcctgaaccccggcgttcctgagaatggc
taccagacattgtacaagcatcattaccaagcgggggagtcactacgcttcttctgctat
gagggctttgagctcatcggcgaggtcaccatcacctgtgtacctgggcacccctcccag
tggacaagccagcccccactctgcaaagtggcctatgaggaactcctggacaaccgaaaa
ctggaagtgacccagactacagatccatcacggcagctggagggtgggaatctcgctttg
gctatcctgttgcccctgggcttggtcattgtccttggcactggtgtttacatatactac
actaagctacaaggaaaatccctctttggcttctcgggctctcactcctacagtcccatt
accgtggagtcagacttcagcaacccactgtatgaagctggggatacaagggaatatgaa
gtttccatctaa

DBGET integrated database retrieval system