KEGG   Rattus norvegicus (rat): 309004Help
Entry
309004            CDS       T01003                                 

Gene name
Vkorc1
Definition
(RefSeq) vitamin K epoxide reductase complex, subunit 1
  KO
K05357  vitamin-K-epoxide reductase (warfarin-sensitive) [EC:1.17.4.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00130  Ubiquinone and other terpenoid-quinone biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    309004 (Vkorc1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.4  vitamin-K-epoxide reductase (warfarin-sensitive)
     309004 (Vkorc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VKOR
Motif
Other DBs
NCBI-GeneID: 309004
NCBI-ProteinID: NP_976080
RGD: 1303107
Ensembl: ENSRNOG00000050828
UniProt: Q6TEK4 B2GUU6
Position
1q37
AA seq 161 aa AA seqDB search
MGTTWRSPGRLRLALCLAGLALSLYALHVKAARARNEDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGADSILNQSNSIFGCMFYTIQLLLGCLRGRWASILLILSSLVSVAGSLYL
AWILFFVLYDFCIVCITTYAINAGLMLLSFQKVPEHKVKKP
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccacctggaggagccctggacgtttgcggcttgcactatgcctcgctggccta
gccctctcactgtacgcactgcacgtgaaggcggcgcgcgcccgcaatgaggattaccgc
gcgctctgcgacgtgggcacggccatcagctgttcccgcgtcttctcctctcggtggggc
cggggctttgggctggtggagcatgtgttaggagctgacagcatcctcaaccaatccaac
agcatatttggttgcatgttctacaccatacagctgttgttaggttgcttgaggggacgt
tgggcctctatcctactgatcctgagttccctggtgtctgtcgctggttctctgtacctg
gcctggatcctgttctttgtcctgtatgatttctgcattgtttgcatcaccacctatgcc
atcaatgcgggcctgatgttgcttagcttccagaaggtgccagaacacaaggtcaaaaag
ccctga

DBGET integrated database retrieval system