KEGG   Rattus norvegicus (rat): 309008Help
Entry
309008            CDS       T01003                                 

Gene name
Inpp5f
Definition
(RefSeq) inositol polyphosphate-5-phosphatase F
  KO
K21798  phosphatidylinositol 4-phosphatase [EC:3.1.3.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    309008 (Inpp5f)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    309008 (Inpp5f)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     309008 (Inpp5f)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syja_N hSac2
Motif
Other DBs
NCBI-GeneID: 309008
NCBI-ProteinID: NP_001101024
RGD: 1305777
Ensembl: ENSRNOG00000020388
UniProt: D3ZKG7
Position
1q37
AA seq 1130 aa AA seqDB search
MELFQAKDHYILQQGERALWCSRRDGGLQLRPATDLLLAWNPICLGLVEGVIGKIQLHSD
LPWWLILIRQKALVGKLPGDHEVCKVTKIAVLSLSEMEPQELELELCKKHHFGINKPEKI
VPSPDDSKFLLKTFTNIKSNVSAPNKKKVKESKEKEKLERRLLEELLKMFMDSESFYYSL
TYDLTNSVQRQSTGEKDGRPLWQKVDDRFFWNKYMIQDLSEIGTPDVDFWIIPIIQGFVQ
IEELVVNYEPSDDDKSSPETPPQEATCVDDIHPRFLVALISRRSRHRAGMRYKRRGVDKN
GNVANYVETEQLIHVHNHTLSFIQTRGSVPVFWSQVGYRYNPRPRLDKSEKETVDCFCAH
FEEQLKIYKKQVIVNLVDQAGREKIIGDAYLKQVLLFNNPRLTYVSFDFHEHCRGMKFEN
VQTLTDAIHDIILDMKWCWVDQAGVICKQEGIFRVNCMDCLDRTNVVQAAIARVVMEQQL
KKLGVMPPEQPLPVKCNRTYQIMWANNGDSISRQYAGTAALKGDFTRTGERKLAGVMKDG
VNSANRYYLSRFKDAYRQAVIDLMQGIPVTEDLYSIFTKEKEHEALQKETQRSHQELISQ
LLQSYMQLLLPGDEKFHGGWALIDCDPSLTDAAHRDVDVLLLLSNSAYYVAYYDDEVDKV
SQYQRRSLEDLEKIEIGPEPTLFGKPKFSCMRLHYTCKEAGGYFHTLRAVPRSPEEDGKD
TLQCIAEMLQITKQAMGLHVPIIERKLERKSSKPHEDIIGIRSQNQGSLAQGKSFLMSKF
SSLNQKVKQTKSNVNIGNLRKLGNFTKPEVKVNFLKPNLKVNLWKSDSSLETMENPGVMG
NKVQGESDGDVSSDNDSYHSDELLTNSRSEEGKQLANSLESAGPTDYLLPSCGIIASAPR
LGSRSQSASSTDVSIHAPSEATVGHGHELGKGLESPLKKSPSADNIHTLTGFAKPMDVYC
QRFVQDAQNKMNALSEVRAVAQNSEEGNHKTNPVSNEETQSESVEQMPSRPSQLNVSCSV
TGPQLLSVEPAHPAVSQKTPGSGSSLLDLEAGLCVTPSSESSSRAVSPFAKIRSSMVQVA
NITQAGLTHGINLAVAKVQKSPAEPEVVNEIQQNELKNMFTQCQTRIIQI
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atggagctctttcaggccaaggaccactacatcctgcagcagggcgagcgtgccctgtgg
tgcagccggcgcgacggcggcctgcagctccgaccggccactgacctacttcttgcctgg
aaccccatttgtttgggattggtagaaggagtaattgggaagattcaactccattcagat
cttccgtggtggcttattttaattcggcagaaagcattggtgggcaaactcccaggagac
catgaggtctgtaaagtcaccaagattgctgtattgtcactttctgaaatggaacctcag
gagcttgagctggagctctgcaagaagcatcattttggaattaacaagcctgagaagatt
gtaccatctcctgatgactccaagtttctactgaagacattcacaaatatcaaatccaat
gtgtctgctcccaacaaaaagaaagttaaagaaagtaaagaaaaggagaaactggagagg
cgtttgcttgaggagttgctgaagatgttcatggactcagagtccttctattatagcttg
acctatgacctaaccaactcagtgcagaggcagagcactggggagaaggatggccgcccc
ctgtggcagaaggttgatgatcgatttttctggaataagtacatgatccaagacctctct
gagattggtactccggacgtggacttctggatcatccccattatccagggttttgtgcag
attgaagaactggtggttaattacgagccatctgatgatgacaagagcagcccagagacg
ccccctcaggaggccacttgtgtagatgacattcacccgcgatttctagtggctcttata
tctcgcaggagtaggcacagagcaggaatgcggtataaacgaagaggagtggataaaaat
ggaaatgttgcaaattatgtggagactgagcagttaattcatgttcataatcatactctg
tcgtttattcaaactcgaggctccgtgcccgtcttttggagccaggttgggtatcgctat
aatccaagacctcgactagacaaaagtgagaaggagacagtcgactgtttctgtgcccat
tttgaagaacaactgaaaatttacaaaaagcaggttattgttaacttggtggaccaggct
ggaagggagaagatcattggtgatgcttacctgaagcaggtgctgctcttcaacaacccc
aggctcacctacgtctcctttgatttccacgagcactgccgaggaatgaagtttgagaat
gttcaaaccctaacggatgccattcatgacatcatccttgatatgaagtggtgttgggtt
gatcaagctggtgtgatatgtaagcaagaaggaatttttcgagttaattgcatggactgc
ctggatcgcaccaacgtggtccaagctgccattgcacgagtggtcatggaacagcagctt
aaaaaactaggtgtgatgccccctgagcagccactacctgtgaaatgtaatcggacctac
cagataatgtgggctaacaacggcgactccatcagcagacagtatgctggcacagctgct
ctaaagggcgactttacaagaacaggagaaaggaagttggcaggagttatgaaagatgga
gttaactcagcaaataggtactacctcagccggttcaaggatgcttacaggcaagctgtc
atagatttgatgcaaggcattccagtgacggaagatctttattccatatttaccaaggag
aaggagcatgaagctttgcagaaggagacccagagaagccaccaagagctcatcagccag
ctcttacagagctacatgcagttgctgctgccgggggatgagaagttccacgggggctgg
gccctcattgactgtgaccccagcctcactgatgctgctcacagagatgtggacgtgcta
ctgctgctttctaattctgcctactatgtggcctattatgatgatgaagttgataaagta
agccagtatcaacgacggagccttgaagacctggaaaagatagaaataggtcccgagcct
actctttttggcaaaccaaagttctcctgcatgcggctgcactacacgtgtaaagaagca
ggtggttacttccacacactgagagccgtaccacgcagtcctgaagaagacgggaaagat
actctccagtgcattgcggagatgctgcagatcaccaagcaggccatggggctgcatgtg
cccataatcgagaggaaactcgagaggaagagcagcaagcctcatgaagacatcattggt
atcagatctcaaaaccaaggctctctggcccaggggaaaagctttttaatgagcaaattt
tcatctctaaatcaaaaagtaaagcagaccaaatccaatgtgaacattggcaacctacgc
aaattaggaaactttacaaagcctgaagtgaaagtgaactttctaaaaccaaacttaaaa
gtcaacctttggaaatcagatagtagtcttgagaccatggagaacccaggagtgatgggt
aacaaggtccagggggagtctgatggggacgtgtcctcagataatgactcttaccactct
gatgaactccttacaaactccaggtctgaggaaggcaagcagctagccaactctttggag
agcgcagggccaacagactaccttctcccgagctgtggcatcatcgcctcagcgcctcgg
ttaggcagccggtcccagtcggccagcagcaccgacgttagcatccatgctccctcggaa
gctactgttggtcatggacatgagctcggaaaaggcctggagtctcccctgaagaaaagc
ccttctgctgacaacatacacacattgactggctttgcaaagcccatggacgtttactgc
cagagattcgtgcaggatgcacagaacaaaatgaacgcgctgtcggaggtcagggctgta
gctcagaacagcgaggagggaaatcacaagactaaccctgtttctaatgaagaaacccag
tcagaatcagtggaacagatgccttctcggccctctcagttaaatgtctcttgttctgtg
acaggcccacagttgttatcagttgaaccagcacatccagcggtatctcagaagaccccc
ggctccgggtccagcctgctggaccttgaggcagggctttgcgtaactccttcttcagag
agcagcagcagagcagtctctccctttgcaaagatccgcagctccatggtccaggttgct
aatattacccaagctgggctaactcatgggataaacttggcagttgccaaagttcagaag
agtccagcagaacccgaagtggttaacgaaattcaacaaaatgaacttaaaaatatgttt
acacaatgccagacacgaataattcagatttag

DBGET integrated database retrieval system