KEGG   Rattus norvegicus (rat): 309009Help
Entry
309009            CDS       T01003                                 

Gene name
Mcmbp, MCM-BP, RGD1306730
Definition
(RefSeq) minichromosome maintenance complex binding protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MCM_bind
Motif
Other DBs
NCBI-GeneID: 309009
NCBI-ProteinID: NP_001034697
RGD: 1306730
Ensembl: ENSRNOG00000020394
UniProt: B1H268
Position
1q37
AA seq 642 aa AA seqDB search
MPCGEDWLSHPLGIVQGFFAQNGVTPDWEKKVIDYFKEKLKENNAPKWVPSLNEVPLHYL
KPNSFVKFRCMIQDMFDPEFYMGVYETVNQNTKARVLHFGKYRDVAECGPQQELDLNSPR
STTSERQTFYCVPVPGESLWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDEDMDLQPNK
QKDQHSGARQAGGLGGLHWRGEPKRLETEASSGQQLNSLNLSSPFDLNFPLPGEKGPACL
VKVYEDWDCFKVNDVLELYGVLSVDPILSILNNEERDASALLDPMECTDMAEEQRVHSPP
ASLVPRIHVILAQKLQHINPLLPTCLNKEESRTCQFVSNFMSELSPVRAELLGFLTHALL
GDSLAAEYLILHLISTVYTRRDVLPLGKFTVNLSGCPQNSTFTEHLYRIIQHLVPASFRL
QMTIENMNQLKLIPHKDYTANRLVSGLLQLPNNTSLVIDETLLEQGQLDTPGVHNVAALS
NLITWQKVDYDFSYHQMEFPCNINVLITSEGRSLLPADCQIHLQPQLIPPNMEEYMNGLL
SAVLPSVLNKFRIYLTLLRFLDYNLSDDITKAVEDDFVEMRKNDPQSITADDLHQLLVVA
RFLSLSAGQTTLSRERWLRAKQLEHSRRSRLQQQKSVNGNEL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtggagaagactggctgagccacccgctcgggatcgtgcaaggcttcttcgca
caaaatggagttactcctgactgggagaagaaagttattgactacttcaaggagaagctg
aaggaaaataatgctcctaaatgggtaccatcgttgaatgaagtcccccttcattatctg
aagcctaacagctttgtcaagttccgttgcatgattcaggatatgtttgaccccgagttt
tacatgggcgtttatgaaaccgttaaccagaacacaaaagcacgggttcttcattttgga
aaatacagagatgtagcagaatgtgggcctcaacaagaacttgacttaaactctccacgg
tcaaccacttcggaaagacagaccttttactgcgtcccagtgcctggggaatctttgtgg
gtcaaagaggcctatgtcaatgcaaaccaagctcgagtcagcccttcgacttcttacact
cccagtagacacaagaggagttatgaagatgatgaagatatggacctacagcccaataaa
cagaaagaccaacattcaggtgcccggcaagcaggaggcctcgggggccttcactggcgc
ggagagccaaaacgcttagagactgaagcttcctctgggcagcagctgaactccttgaac
ctctcttccccatttgatctgaactttcctctgcctggagaaaaaggccctgcctgcctt
gttaaggtctatgaagattgggattgcttcaaagtcaacgatgttcttgagttgtatggt
gtgctctctgtggaccctatcctgagcatactgaataatgaagaaagggatgcctctgca
ctgctggaccccatggaatgcacggacatggccgaagagcagagagtgcatagccctccc
gcttcactagtgccaagaattcacgtgattttagcccagaagctgcagcacatcaatcca
ttgttacccacttgccttaacaaggaggagagcagaacctgtcagtttgtgtccaatttc
atgtccgagttgtctccagtcagagcagagctgcttggattcctcactcatgcactcttg
ggagacagtttggctgctgaataccttatattgcatctcatctccaccgtgtatacaaga
agagatgtacttccactgggaaaatttacagttaacctgagtggttgcccacagaacagc
accttcacggaacacctatatcggatcatccaacatcttgttccagcatctttccgtcta
cagatgacaatagaaaacatgaaccagttgaaactcattccccacaaagactatacagcc
aaccgactggtcagcggcctccttcagctgcccaacaacacttccctggtcattgatgag
actcttctggagcaagggcaattggacacgccaggtgttcataacgtagccgccctgagc
aatctcataacctggcagaaggtggactatgacttcagttaccaccagatggagttccca
tgtaacatcaacgttctcatcacatccgaggggaggtcactacttccggcagactgccag
attcacttacagccccagctgataccacccaatatggaggaatacatgaacggcctgctc
tcagctgtgctgccgtccgtgctcaacaagttccgaatctacctgactttgctgagattc
ctggattacaacttatcagacgacataaccaaggcagttgaagatgattttgtggaaatg
cgtaaaaatgaccctcagagtatcacggctgatgatctccaccagttgcttgtggtggct
cggtttctgtctctgagcgcgggtcagacaacactctccagagagcgatggctcagagca
aagcagctggagcactccaggagaagcaggctccagcagcagaagagcgtgaatgggaac
gagctttag

DBGET integrated database retrieval system