KEGG   Rattus norvegicus (rat): 309025Help
Entry
309025            CDS       T01003                                 

Gene name
Tacc2
Definition
(RefSeq) transforming, acidic coiled-coil containing protein 2
  KO
K14282  transforming acidic coiled-coil-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    309025 (Tacc2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   TACC proteins
    309025 (Tacc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TACC_C Skp1_POZ
Motif
Other DBs
NCBI-GeneID: 309025
NCBI-ProteinID: NP_001004415
RGD: 1303004
Ensembl: ENSRNOG00000020457
UniProt: D3ZXK3
Position
1q37
AA seq 2834 aa AA seqDB search
MGNENSTSDHQRTSSVQSLRSLQPPGNSQTPQKQGDSPGSGAASTGLGASCSASESVASL
DPSTVSPEVTKPGEHPQEARDPEDSPLPRSSLPWEQPYPSASMPFTEGLSEGCLANSEAE
VPEDGPLTNHLRVEPSPNGPGDILLTFTPEVDGPAQRTVAARTPSAEGDQELKEEGQSSS
SSCTGQSPGISFVPLQEPKTELLYGKGDWPRDFEFQRKDDIDNCSSPESVTKAPAATQPG
MQNSAVLECPPKLETMVPQDSVLRSSDSKKGRSEVLPMDLAKHVEFLGGCHPSKGNSGAN
PGAGTSPASQESCQLRVGMPLPSAELPSGPQGLTTARADGGSWEETLDTSSAQSQPQTGT
SGAEPQQVVCVPAASQPGGSLLLSAKAPGFTGTEERHTASSPTARLTAWSSTASEEPTEA
VSETKMSVSADLAATGQMGPGVVELKPTSDLRRTQEQPPEGSCLQWVPAPFLQGRNDTIQ
EGLLLPPFSHQVSNESSRRSMGPTDDPKASKNTENRVVAREESIPHGDNRKGQQEATRAL
AGTELRNHDKEKSHAFRAKPRGDTEKDDISELHSNKENKIVPSSDSTQPPRQEVAESHMT
DTATSLHEVHEEDPILSSASDGTGEHFLPQDAIWESSRLQTESSVMLQARGGLEATESLP
VLESEKADALPATAMEEEAPRAAEMEDVLEVKKDHSPLHQPYSCAGQGLPMSPGQPCGLE
KVEPGQEDHADTSSPPNGKNSTIGDGLTVPRLEQDGQRKLSCPEASLPPPLQNPLLSSQL
DPDAAISAVLCDKDQSPTNGQRACLCGPGLKEQSTDPSPIPVSEEGKPWADVSLSTQGGK
EQGSELPSKGSLCDTPSSSPKGTVLGGAPSEMSELSTPLGQELPALGGNEQENTGRNSQP
SEIQPPSASLTGHSGGKDSFCVGQGLSKSQQELADALQTGSQREEARCGDSGISEATGVL
PPPRGLEKIETASRNIAEAPPGPPDSVALLDTAYCSPDPVPTNPGVAPAHDALVSEACDE
SQKESVPQLDMEQRATLGPEEQSPLGSFRRAEEQDSKEGSAEVSVDASDGDPKMQQASEA
PEAALSSGFFQADQSLPSTLKEPRQPAKLEPSCGDALLPAGESNGIPRSTVGVLTHRAVS
GPQSLLPAEPPEETVPDTPYLHISGAAKKDAEDASMRAVFSEDPGAPHESPIKEPPPVEN
DTPGKSPAVSFTTDLQPGTAHGEISVAGDGDGIPQAGTTEGHVSLTPYLDRMPLLVRDEQ
VAREMHVAATPETNARPSETAVCPASEEAAGETGGSRERAVELTPDLMVVTSGSEGASSK
QPSVIKGLPDFREHITKIFEQSVFGALAADRTHSVPSKKSGVPSSMLVEGPVISLDSGKL
PDGVQGMAAAPLPVPPVGLQVEKKQESGVKAEVSHPVPQDPAPEKLMGLAEAALEESLPG
AIVEGEVTRVPLTVTSERLEGTGEPGQGAQAHTQQARSRQELVVGLPSSKAVQGVPAEPA
PGFPVDPQSHADADEASSQGDKSHSVKEYLETLPSNSPHGINGAQDSVHTKGPSNLLGST
CALDGSSPHGSVLNMPESNSEPWIPSTLGGERQLEAAVCTSDKQNVLENQDGPKMLAREV
LAIPLGPSNMAGAAEEAEGDVTPSRPETWAEVSGDLLETGTTRMLPHEAGDSAPPGSYRD
SGCSNRTQVMEDTATLPGDSQVGCQQAKEPLGPQLPAPYGKTSVSSPPEPDESSDEKLHL
LAPEVLTDSIPGTNDVIQSAAPEDLGHPPLADSSRYGVTVSSVSTHLTVQSTSPSAAHAS
LAPVASEHAALASAAAGPGVETPTASCQHLAKNINRSSDSEEAFETPESTTPVKAPPAPP
PPPPEVTPEPEVIEPPAPEEPGCISEPVVVPDGPRSESVEGSPFRPSHSSSAVFDEDKPI
ASSGTYNLDFDSIELVDNFQSLEPCSADYKGQECKVSTRRKSTESVPPSKTTLSRSLSLQ
ASDFDGASCPGSPEAGTLATDACGTGSNSASSTLKRTKKTRPPSLKKKQATKKPTETPPV
KETQQEPGEESPVPSEEHLAPETKTESATPEGTGCTLSEETSLESAAVPTATCPLTLESV
EDVSPLVSGGGRVQNSPPVGRKSVPLTTASEAVEVTLPDGGGQEDLPAKGLSVRLEFDYS
EDKGSWESQQENAPPTKKIGKKPVAKMPLRRPKLKKTPEKLDNTPASPPRSPAEPSDIPI
AKGTYTFDIDKWDDPNFNPFSSTSKMQESPTLSQQSYNFDPDACEESLDPFKASSKTPSS
PSKSPASFEIPASTIEADGDGLNKPAKKKKTPLKTDTFRVKKSPKRSPLSDPPSQDPTPA
ATPEAPPVSTVVHATDEEKLAVTSQKWTCMTVDLDADKQDFPQPSDLSNFVNETKFNSPS
EELDYRNSYEIEYMEKLGSSLPQDDDTPKKQALYLMFDTPQESPVKSPPVRMSDSPTPCS
GSSFEDTEALVNATAKLQHPVPRGLASNQEPLLQLPEKSSQKELEAMALGTPAEAIEITA
PEGAFASADALLSRLAHPASLCGALGYLEPDLAEKNPPVFAQKLQEELEFAVMRIEALKL
ARQIALASRSRQDTKREATHPPDVSISKTTLYSRIGPTEVEKPPGLLFQQPDLDSALQVA
RAEVIAKEREVSEWRDKYEESRREVVEMRKIVAEYEKTIAQMIEDEQREKSISHQTVQQL
VLEKEQALADLNSVEKSLADLFRRYEKMKEVLEGFRKNEEVLKKCAQEYLSRVKKEEQRY
QALKVHAEEKLDRANAEIAQVRGKAQQEQAAYQASLRKEQLRVDALERTLEQKNKEIEEL
TKICDELIAKMGKS
NT seq 8505 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgagaacagcacctcggaccaccagaggacttcttcagttcagagtctaaga
tcactgcagccacccgggaacagtcaaactccacagaagcaaggagactcacctggatcc
ggcgctgcaagcactgggcttggagcctcctgctctgcttctgaaagtgttgccagcctg
gatccgagcactgtgtccccagaggtgactaagccaggggagcacccacaggaagccagg
gacccagaagattctccactgcccagatcatctctgccctgggaacagccgtacccctca
gcctccatgcctttcacggagggcctctcagaaggttgcttggcaaactcagaagcggaa
gtacctgaagatggtcccctcacaaatcaccttagagtggaaccctcccccaacgggcca
ggggatatcttactgacatttactcctgaagtggatggccccgcacagcgcacagtggct
gccagaacccccagtgctgaaggagaccaagagctgaaggaagagggacagagctcatcc
tccagttgcactggccaatcgccaggaatttccttcgttcctctccaggagccaaagaca
gagctgctctatggaaagggtgactggcctcgtgactttgagttccaaaggaaagatgat
atcgacaattgttcctccccagagtcagtcactaaagcccctgctgccactcagccgggg
atgcaaaattcagctgtccttgagtgccccccaaaacttgagaccatggtcccacaagat
tcagtcctaagatcctcagacagtaaaaaaggcagatcggaagtgctacctatggatttg
gccaaacacgtggaatttctcggaggctgccatccctctaaaggcaactctggagctaac
cctggagcaggaacaagccctgcctcccaggaaagctgtcagctgagagtgggaatgcct
ctgccatctgcagaactaccttcaggcccacaaggccttaccacagcacgagcagacggt
ggctcctgggaagagactctggacaccagcagcgctcagagccaaccacagacagggaca
tcaggagctgagccccagcaagttgtctgtgtgccagcagccagccagccgggtgggagc
ttgcttctgagcgccaaggcccctggattcactggaacagaggaaagacatacggcttca
agtcccactgcgcgcctgacagcttggagttctactgcctcagaagaacccacggaggct
gtttctgagacgaagatgtcagtttctgcagatctggctgccacaggacagatgggtcca
ggggtggtggaactgaagccaacatcagatcttagaagaacacaagaacaacctcctgaa
ggtagctgcctccagtgggttcctgcgcctttcttgcaggggcgaaatgatacaatccaa
gaagggctgttgctgccacctttctcccatcaggtttcaaatgaaagttctagaaggtca
atgggaccaactgatgatcccaaggcctccaagaatactgaaaatagagttgtggctaga
gaggaaagcataccgcatggagacaaccgtaagggacagcaagaagccaccagagccctt
gctggtacagagcttaggaaccatgacaaagagaagtctcatgcctttcgtgccaagccc
cgtggggacactgagaaagatgacatttcagagctacacagtaataaagagaacaagatt
gtccccagctcggactcaacacagccacctaggcaggaggttgctgaatcccatatgacc
gacacagctacctcactgcacgaagtccacgaggaggaccccatcctgtcctccgcatcg
gatggaactggtgagcactttcttccccaagatgccatctgggaaagttcaagattgcag
actgaaagctctgtcatgcttcaggccaggggaggattggaagcaacagagtcacttcct
gttttagaatctgagaaagcggatgccctgcctgctacagctatggaggaggaggcaccc
agagctgcggagatggaggatgtactggaagtaaagaaggaccactcacccttgcatcag
ccctacagctgtgccgggcaaggcttgccgatgtccccaggccaaccttgtgggctggag
aaggttgaacctggacaggaagatcatgctgatacgtcatctccccccaatgggaaaaat
tcaacaataggcgacggacttaccgtgccccgtctggaacaagacggtcagagaaaactg
tcctgcccagaggccagtctcccaccacctttacagaaccctctcctgtcatctcaacta
gacccagatgcagccatctctgctgttctctgtgacaaggaccagtcacctacaaatggg
caaagggcttgtctgtgtggcccaggtctgaaggagcagagtacagatccttctccaatc
ccagtgtctgaggaagggaagccttgggcagacgtgagcttgtctactcaaggaggaaag
gaacaggggtcagaacttccctccaaaggcagcctgtgcgatactccaagttcatcaccc
aagggtacagttctgggaggggcaccgtcagagatgtcagaactgtcaaccccactggga
caagagctgcctgcactagggggaaatgagcaagagaacacgggcagaaacagtcaaccc
tcggagatccagcctccttcagcctctcttacaggacactcgggtggaaaggatagtttc
tgtgttgggcaggggctgagcaagtcccaacaggagctggctgatgctttgcaaacagga
agccagcgtgaagaagcacgttgtggggactcgggcatttctgaagccactggcgtcctg
cctccgcctcggggcttggagaagatagagacagcaagtagaaacatagcggaggcccca
cctggtccacctgactcagtagctctcttggatacagcatactgctctccagacccagtg
cctaccaatcccggagtcgcacccgcccacgatgccctagtgagcgaggcctgtgatgag
agccagaaagagtcggtcccacagctggatatggagcagcgggccaccttaggtccagaa
gaacagagtcctcttggaagtttccggagagcagaggaacaagatagtaaagaaggatca
gcagaggtgagtgtcgatgccagcgacggagaccccaagatgcagcaggcgtcagaggca
ccagaagctgctctgagtagtggcttcttccaggctgaccagagcctcccctccaccctg
aaggagccacgccagcctgcgaagcttgagcccagctgtggggatgctttgctgccagct
ggagaatcgaatgggattcccagaagtactgtgggtgttctgacacaccgcgctgtttca
ggcccacagagccttctgccggctgaaccacctgaagagactgtgcctgacaccccttac
ctgcatatcagtggtgctgccaagaaggatgccgaagatgctagcatgagagctgttttc
tctgaggaccccggagcacctcatgaaagtcctataaaggagcctccacctgtggaaaac
gacacccctggaaagagccctgctgtctccttcaccacagacttgcaaccaggaactgca
catggggaaatctccgtagcaggggatggcgatggtatcccccaagctggaaccactgag
ggacatgtgagtctcacgccctacctggacaggatgcctctcctggtgagagatgagcag
gtggcaagagagatgcatgtggctgccaccccagaaacaaatgctaggccctctgagact
gcagtgtgccctgccagcgaggaagcagcaggagagacagggggcagcagagaaagggca
gtagaacttaccccagacctgatggttgttacatcaggtagtgagggtgcaagctccaag
cagcccagcgtaatcaaggggcttcctgacttcagggagcacatcaccaagatctttgag
cagtctgtgtttggagccctggctgctgatcggacccatagtgtgcctagtaaaaagtca
ggagttccaagcagtatgctggttgagggccccgtgatctcactggactcagggaagctt
ccagatggggtgcaaggaatggctgctgcccctctccctgtacctcctgtaggactccag
gtggagaagaagcaagagtcaggtgtcaaggctgaggtttctcatccagttccccaggat
ccagcaccagagaagctgatgggtctggcggaggcagccttggaggagagcctgccaggt
gccattgttgaaggagaggtgacccgtgtcccactgacagtgacaagtgagaggctagag
gggactggggagcctggccagggagctcaggctcacacacagcaggcaagaagcaggcag
gaattagttgtgggtcttccctcttctaaagctgttcagggggtacctgcagaaccagct
cctggcttccctgtggatccccagagtcatgcagatgcagatgaggcttcttctcaaggt
gacaaaagccattctgtaaaagagtacctggaaacgctgcccagcaacagtccacacgga
ataaatggtgcccaggactctgtccacaccaagggtccaagtaatctattaggatccacc
tgtgccctggatggctcctctcctcatggaagtgttttgaatatgcccgaatccaacagt
gagccctggatcccttccacacttgggggtgagagacagctggaagctgctgtctgtacc
tcagataagcaaaacgtgctggaaaaccaggatggccccaaaatgttggctagagaagtg
ttggcgattcccctggggcctagcaacatggcaggagctgctgaggaagcagaaggtgat
gtcaccccaagcaggcctgagacgtgggcagaggtgtctggtgacctccttgaaacaggt
actacaaggatgcttccccatgaggcaggtgactcagcaccgcctgggagctatcgggat
tcaggatgctccaacaggactcaggtgatggaggacacagccacccttccaggggacagc
caggttggatgccagcaggccaaggaaccgctgggccctcaactcccagctccttacggg
aagacgagtgtctcttcccctccagagcctgatgaaagcagtgacgagaagctgcacctc
ctggctccagaagtcctcactgacagcatccctggaaccaatgatgtcatccagtcagct
gctcccgaagacctgggacacccacccttagctgattcttcccgctatggtgttactgtc
agctcagtctctacacatctgacagtccagagcacctccccatctgctgcccatgcaagt
cttgctcctgtggcctcagaacatgcagccttggcttccgccgcagctggtcctggagta
gaaacccccactgcctcctgccaacacctggccaagaacataaacaggagttccgactct
gaggaagcctttgagacccccgagtcaacaacccctgtcaaagctccaccagctcctccc
cctccaccccctgaagtcaccccggagcctgaggtcatcgaaccaccagccccagaagaa
ccaggatgcatttctgagccggtcgtggttcccgatggccctcgcagcgagtccgtggaa
ggaagccctttccgtccttcgcactcctcctcggcggtgttcgatgaagacaagccgata
gccagcagcgggacatacaacttagactttgacagcatcgagctggtggataactttcag
agtttggagccatgctctgccgactataagggtcaggagtgtaaggtgagcacgcggagg
aaatccaccgagtccgtgccaccctccaagaccacgctgtcccgctcgctcagcctgcaa
gccagcgacttcgacggtgcttcgtgccccggcagcccggaagctgggacccttgccaca
gatgcgtgtggcacaggatccaacagtgcttctagcacccttaagcgaactaaaaaaaca
cggccaccttccttaaaaaagaaacaagctaccaagaaacccacagaaacccccccagtg
aaggagacccaacaggagccaggtgaagagagtccggtgcccagtgaggaacacttagca
ccagagacaaagacagaatcggccacacctgagggcactggttgcaccttgtcagaagag
acatctctggagtctgctgctgtgcccacagctacctgtcctctgactttggagagtgtg
gaagacgttagccctctggtttctggaggtggcagagtgcagaactcaccccctgtgggg
aggaaatcagtgcctcttaccacagcctctgaggcagtggaggtgacgctgccggacggt
ggggggcaagaggacttgcctgccaaagggctgtcagtgaggctggagtttgactactct
gaggacaagggaagttgggagagtcagcaggagaacgcccctcccaccaaaaagataggc
aagaagccagttgccaaaatgcccctaaggaggccaaagctgaaaaagaccccagagaaa
ctggacaacactcctgcctcacctccaaggtcccctgctgaacccagtgacatccctatt
gctaaaggtacctacacctttgatatagacaagtgggatgaccccaattttaaccctttt
tcctccacctcgaaaatgcaagagtctcccacactgtcccaacaatcgtacaactttgac
cccgacgcctgtgaagagtcccttgacccctttaaggcatcctctaagacccccagttca
ccttctaaatccccagcctctttcgagatcccagccagcaccatcgaagcggacggggat
gggttgaataaacccgccaagaagaagaagactccattgaagactgacacatttagggtg
aagaagtctccaaagcggtctcctctgtctgatccgccttctcaggaccccactccagct
gccacaccggaagcacctccagtctctaccgtggtccacgccacagatgaggaaaagttg
gccgtcactagccagaagtggacatgtatgacagtggacttggatgctgacaaacaggat
ttcccgcagccctcagacctatctaactttgtaaatgagaccaaattcaattcaccctcg
gaggagctggactacagaaactcctatgaaattgaatacatggaaaagcttggctcctcc
ttacctcaggacgatgacactccgaagaagcaggccttgtaccttatgtttgacacccct
caggagagccccgtcaagtctcctccggtccggatgtcggattccccaactccatgttca
gggtcgagttttgaggacaccgaagccctggtgaatgcaacagcaaagctccagcatcca
gtccctagagggctggcctccaatcaggagcctctcttgcagctgccggaaaaatcctcc
cagaaggagctggaggccatggccttgggcacccccgcagaagcaattgaaatcacagct
ccagagggtgcctttgcctctgcagatgccctcctcagcaggctggcccatcctgcttct
ctctgtggtgcacttggctatctggagcctgatttagcagaaaagaaccccccagtattt
gcccagaaacttcaggaggaattagagtttgctgtcatgcggatagaagccttgaagctg
gccaggcagatcgccctggcttctcgcagccgccaggacaccaagagggaagccactcac
ccaccagatgtctccatctccaaaactaccttgtactcccgcatcgggcccaccgaggtg
gagaaacccccaggccttctgttccagcagccagacctggactctgcactccaagttgcc
agagcagaggtcatcgccaaggagagagaagtctcagagtggagggataaatatgaagaa
agccggcgggaagtggtagaaatgaggaaaatcgtggctgaatacgagaagaccatcgca
cagatgatcgaggatgaacagagagagaagtccatctcccaccaaaccgtgcagcagctg
gtgctggagaaggagcaagccctggctgacctgaactctgtggagaagtctctggctgac
ctcttcaggcgatacgagaagatgaaggaggtgctggaaggctttcgaaagaatgaggag
gtgctgaagaagtgtgcacaggagtacctgtcccgcgtgaagaaagaggagcagaggtac
caggccctgaaggtgcatgcagaagagaaactggacagagccaatgcagagattgcccag
gttcgaggcaaggcccagcaggagcaggcggcctaccaggctagcctgaggaaggagcag
cttcgagtggatgctctagaaagaacgctggagcagaagaataaagagatagaagaactc
accaagatttgtgacgaactgattgccaaaatggggaaaagctaa

DBGET integrated database retrieval system