KEGG   Rattus norvegicus (rat): 309069Help
Entry
309069            CDS       T01003                                 

Gene name
Edrf1, RGD1306820
Definition
(RefSeq) erythroid differentiation regulatory factor 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 DUF2315
Motif
Other DBs
NCBI-GeneID: 309069
NCBI-ProteinID: NP_001101027
RGD: 1306820
Ensembl: ENSRNOG00000017728
UniProt: D3ZRW6
Position
1q41
AA seq 1208 aa AA seqDB search
MMGDPKEAGAEASPSGAAARGGLSLLSQTESEEPSAQGSALFLGGNEVKSRAVVKYSSAP
PRTAFARLEEKTDLKLPPANWLRESAKLGPAGTTILGNSKKSKPFSSFGMAYDFIDSVGN
DVDVVSDSENIKKLLKIPYSKSHVSMAVHRIGRTLLLDELDIQELFMRSSQTGDWTWLKE
FYQRLIDQKWQRKKKSKEHWYQKAILSKFLYYSINGDGAAQPVPSPAEQQESASSDQTHE
SEGASWPAPFEMPSSVSEDPSASSQGLKNDFVRNILWTFEDIHMLVGSNMPIFGGGRYPA
VSLRLRDNNKPINVLTGIDYWLDNLICNVPELVMCFHVNGIVQKYEMIKTEEIPNLENSN
FSTKVIKDIAQNILSFLKSNCTKEGHTYWLFKASSSDIVKLYDLTTLCEETEDKYQNPFT
MPVAILLYKVACNMMMKKNQNKKHYGTIRTLLLNCVKLLDKSRHPQIIASANYMLSELFQ
LDEPKKEESSDSPLNENSDESYSEEEEEEEMADSDENGSYGTSSDPADDNKAVAIIKSVG
ELSVPEKYKSIHQIRPSCAFPVCHDTEERCRLVLSYVLEGLKSVDSSIKKESDLPAADPS
TPIPLKYEDESTRGGPEGLEKQMALFLDKMGSLQKGNCSGQSGMTPGSWQHKMKLQLILK
SSKAYYILSDAAMSLQKYGRALRYIKLALQSHDTYCCLCTNMLSEVLLFLSQYLTLCGDI
QLMLAQNANNRAAHLEEFNYQTKEDQEILHSLHRESSCQGFAWATDLSTDLESQLSVSCK
CYEAANEILQFSDLKSQNPEHYVQVLKRMGNIRNEIGVFYMNQAAALQGERVVSKSVSAA
EQQLWKKSFSCFEKGIHNFESIDDATNAALLLCNTGRLMRVCAQAHCGAEDEFKREFSPE
EGLYYSKAVDYYLKALRSLGTRDMHPVVWDSVNWELSTTYFTMATLQQDYAPLSRKAQEQ
IEKEVSEAMMKSLKHCDVDSATARQPLCQYRAATIHHRLASMYHSCLRNQVGDEHLRKQH
RVLADLHYSKAAKLFQLLKDAPCELLRVQLERVAFAEFQMSSQNSNVGKLKTLSGALDIM
VRTEHAFQLIRKELVEECDQPKNDEATPAADSSPNLNREEVIKLLSIFESRLSFLLLQSI
KLMSSSKRKMSSNTEDDAALQTNKQIYSQLLRATANRNSTLLERIEVVICLLEQLASGSS
GSSGSAVP
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atgatgggggaccccaaggaagcaggagccgaggcttctccatcaggggcggccgcccga
ggagggctcagcctcctatcccagacggaatccgaggagccttctgcacaggggtcagcc
ttatttcttggaggcaatgaagtgaaaagccgagctgtggtgaaatactcttctgcccct
cctcgaacagcatttgcacgtctcgaagaaaaaacagacttgaaactcccacctgccaac
tggttacgagagagtgccaaactagggccggcaggaactaccattcttggcaatagtaag
aaaagcaagccgttttcgagtttcggcatggcatatgacttcattgactcggtgggaaat
gatgtggatgttgtctctgactcggaaaacataaaaaagctcctgaagattccctacagc
aagtctcatgtaagcatggctgtccaccgcataggaaggaccctcttattagatgaactg
gatattcaagaactctttatgaggtcatctcagactggtgattggacatggttgaaagag
ttctatcaaagactgattgatcagaagtggcagaggaaaaagaaaagcaaggagcactgg
tatcagaaggctattctttccaagttcttgtactacagcatcaacggtgatggagctgct
cagcctgttccatctcctgcagaacaacaagagtcagctagttctgatcagacacatgag
tctgaaggggcttcctggcctgctccctttgaaatgccgtcgtcagtttctgaagatccc
agtgcttccagtcagggtcttaaaaatgattttgtccggaatattctgtggacttttgaa
gatatccatatgctagttggttctaacatgcctatatttggtggaggcagatatccagca
gttagcctacgtctcagggataacaacaaaccaattaatgtgttgactggaattgactat
tggttggacaacttgatatgcaatgtaccagaacttgtgatgtgcttccatgtaaatggg
attgtacagaaatatgagatgataaagacagaagaaatccccaatttggaaaactctaat
ttttctactaaagttataaaagacattgcacagaatattttatcgtttcttaaatctaat
tgtaccaaagaagggcatacctactggctctttaaagcaagcagcagtgatattgtgaag
ctctatgacctcacgactctgtgtgaagaaactgaagacaagtaccagaatccattcaca
atgccagtggctatcctcttatacaaggtggcttgtaacatgatgatgaagaaaaatcaa
aacaagaagcactatggaactattagaacattacttctcaactgtgttaagttgttggac
aaaagcagacatcctcaaattattgcttcagccaactacatgctttcagagcttttccag
ttggatgagcctaaaaaggaagaaagttcagactcccctttaaatgagaattcagatgaa
agctacagtgaggaggaggaggaggaggagatggcggacagtgatgagaatggctcctac
ggtaccagctctgacccagcagacgataacaaggcagtggctataattaaatctgttgga
gaactgtcagtaccagaaaaatacaagtcaattcatcagatcagacccagttgtgcattt
cccgtttgccatgacacggaagagcgctgtcgactcgtactaagctatgtgttggagggt
ttaaaatctgtagatagtagcatcaaaaaagaaagtgacctcccagcagctgaccccagc
actcctatccccttaaaatatgaagatgaatccacaaggggtggtcctgaggggctggag
aagcagatggccttgttcctggacaaaatgggctcccttcagaagggcaattgttctggg
cagtctggaatgacccctggttcttggcaacataaaatgaaacttcagctaattctcaag
tcatcaaaagcctactacattttgtcagatgctgccatgagtcttcagaagtatggaaga
gcgttgagatacattaagctagctctgcagagccatgatacttactgctgcctctgcacc
aacatgctctctgaagtgctgctgtttctctctcaatacctgaccctctgtggtgacatc
cagctcatgctggcccagaacgcaaacaacagagcagcacaccttgaggaatttaattac
caaacaaaagaagaccaggagatcctccacagtctccacagagagtccagctgccaggga
tttgcatgggcaacagatctatctacagacttagaaagtcaactttcagttagttgtaaa
tgttatgaggctgctaatgaaatcttgcaatttagtgacttaaaaagtcagaatccagag
cactacgtacaagtgttgaagagaatgggaaacattagaaatgaaatcggtgtattctac
atgaatcaggctgctgcgctgcagggtgagcgagtagtgagcaaatctgtgtctgctgca
gagcaacaattgtggaaaaaaagcttttcttgttttgaaaaggggattcacaactttgag
tcgattgatgatgctacaaatgctgccctcctgctgtgcaacacaggaagactcatgcgg
gtctgtgcacaggcgcactgtggtgcagaggatgagttcaaacgggagttctccccagaa
gagggcttgtattacagcaaggccgttgattactatttgaaggctctgaggtcgctggga
acgagagacatgcacccagttgtttgggattctgtgaactgggaattgtcgactacatac
ttcaccatggcgactctacagcaagattatgctccattatccagaaaagctcaggagcag
attgagaaagaagtcagtgaggctatgatgaagtccctgaagcactgcgatgttgactca
gcaactgctcggcagcccctctgtcagtaccgcgctgcaaccatccatcacaggctggct
tccatgtaccacagctgtctgaggaaccaggttggtgatgagcatcttaggaagcagcac
cgagtgctggcagatctccactacagcaaagctgcaaagctctttcaacttctcaaagat
gctccttgtgaactgcttagagtgcagttagaaagggtggcatttgcagaatttcagatg
agcagtcagaatagcaatgttggaaagttaaaaacattatctggggcacttgatatcatg
gtgagaactgagcatgctttccagctcattcggaaggagcttgtagaggaatgtgaccag
cctaagaatgatgaagctacaccggctgctgattcttcacctaatcttaatcgagaagaa
gtgatcaaactccttagtatatttgaatctcgcctgtcattccttctccttcaatccatc
aaactgatgtcatcatctaaaaggaaaatgagcagtaacacggaagatgatgcagccctc
cagaccaacaagcagatttactcccagcttttgagagcaactgccaacagaaactccact
ctgttggagagaattgaagttgtcatctgtctgctggagcagcttgcatctggtagcagt
ggatcgagtggcagtgctgtcccctga

DBGET integrated database retrieval system