KEGG   Rattus norvegicus (rat): 309098
Entry
309098            CDS       T01003                                 

Gene name
Tubgcp2
Definition
(RefSeq) gamma-tubulin complex component 2
  KO
K16569  gamma-tubulin complex component 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    309098 (Tubgcp2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    309098 (Tubgcp2)
   04147 Exosome [BR:rno04147]
    309098 (Tubgcp2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     309098 (Tubgcp2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     309098 (Tubgcp2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   309098 (Tubgcp2)
SSDB
Motif
Pfam: GCP_C_terminal GCP_N_terminal zf-Tim10_DDP
Other DBs
NCBI-GeneID: 309098
NCBI-ProteinID: NP_001101030
RGD: 1309597
Ensembl: ENSRNOG00000018137
UniProt: B2RYP8
Position
1
AA seq 905 aa
MSEFRIHHDVNELLSLLRIHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTP
EDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQYLQQNAKERAELAASAAASSATGF
SIPVAASKMSTQELEELRKQLGSVATGSTLQQSLELTRKMLRDKQNKKNSGQPLPVFPAW
VYERPTLAGDFLIGSGLSSDTTLPIGTLPLASQESAVVEDLLYVLVGVDGRYITAQPLAG
RQNRTFLVDPNLDLSIRELVNRILPVAASYSTVTRFIEEKSSFEYGQVNHALAAAMRTLV
KEYLILVTQLEQLHRQGLLSLQKLWFYIQPAMRTIDILASLATSVDKGECVGGSTLSLLH
DRSFNYTGDSQAQELCLYLTKAASAPYFEILEEWIYRGVIHDPYSEFMVEEHELRKEKIQ
EDYNDKYWDQRYTVLPQQIPSFLQKVAGKILSTGKYLNVVRECGHDVTCPVAKEIIYTLK
ERAYVEQIEKAFNYASKVLLDFLMEEKELVAHLRSIKRYFLMDQGDFFVHFMDLTEEELR
KPVEDITPTRLEALLELALRMSTANTDPFKDDLKIDLMPHDLITQLLRVLAIETKQEKAM
THADPTELTLSGLEAFSFDYMVKWPLSLIINRKALTRYQMLFRHMFYCKHVERQLCSVWI
SNKTAKQHALHSAKWFAGAFTLRQRMLNFVQNIQYYMMFEVMEPTWHILEKNLKSASNID
DVLGHHTSFLDNCLKDCMLTNPELLKVFSKLMSVCVMFTNCMQKFTQSMKLDSELGRLTL
DQGSVQGPPPESERIDDRPRKEPTRKHLPEHVDTPQLSSGFEATINNFDKNFSAHLLDLL
ARLSVYSTSDCEHGMASVISRLDFNGFYAERLERLSAERSQKAAPQVPVPRGPPAPASRV
AIPAQ
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgagtgaatttcggattcaccatgatgtcaatgagctgctcagcctgctgcgtatccat
ggtggggacggggctgaggtctacattgacctgctgcagaagaaccggacaccatatgtt
acgacaacagtgtctgcccacagtgccaaggtcaaaattgcagagttttctcgaacgcct
gaggactttttaaagaaatatgatgaactgaaatctaaaaatacaaggaaccttgaccca
ctggtgtacctgttatcaaaactcacagaagacaaagagacacttcagtatttgcaacag
aatgcaaaggaaagagctgaacttgcagctagtgctgcagccagcagtgccaccggtttc
agcatccctgttgcagcctctaagatgtccacacaggagctagaggaactgaggaagcag
cttggcagtgtggctacaggctccacactgcagcagtctctggaacttacaagaaagatg
cttcgagacaaacagaacaaaaaaaattcaggccagcccctcccagtcttcccagcatgg
gtatatgagagaccaacactggctggagatttcctgattggttcgggcttgagctcagac
acaactttgcctataggtacattgcccttggcctcccaggagtcagcagtggtggaagat
ctgctctatgtgcttgtgggagtggatggcaggtacatcactgctcagcctttggctggg
aggcagaaccgtaccttccttgtagatcccaacctggacctgtccatccgggagctagta
aacagaatcctccctgtggctgccagctactctactgtgaccaggttcattgaggagaag
tcttcatttgaatatgggcaggtgaaccatgccttggctgctgccatgagaaccctggtg
aaggaatacctgattctcgtcacacaactggaacagctacacaggcagggcctcctctcg
ctgcagaagctctggttctacatccagccagccatgcgtaccattgacatcctggcctcc
cttgccacctccgtggataaaggcgagtgtgttggcgggtcgacgctgagccttctccat
gataggagcttcaactacacaggggacagccaggcgcaggagctgtgcctctatctgacc
aaggcggccagcgctccttactttgagatcctggaggagtggatctacagaggcgtcatt
cacgacccatacagtgagttcatggtggaggagcacgagctgcggaaggagaagatacag
gaggactacaatgacaagtactgggaccagcgctacactgtgctgccacagcagatccca
tccttcctgcagaaggtagcaggcaagatcctcagcacaggaaaatacctaaatgtggtc
agagaatgtggtcatgatgtcacctgtcccgtagccaaagagatcatctataccctcaaa
gagcgggcatatgtggagcagattgagaaagcgttcaattatgccagcaaagtgctgctg
gacttcctcatggaggagaaggagctggtggcccacctgaggtccatcaagcgctacttc
ctgatggaccagggggacttctttgtgcacttcatggacctgactgaggaggagctcagg
aagccagtagaggacattacgcccacacgcctggaggctctgttggagctggccctgaga
atgagcactgccaacactgaccccttcaaagacgacctcaagattgacctgatgcctcac
gaccttatcactcagcttttgcgggttctggccatagagaccaagcaagagaaggcaatg
acccatgctgaccccacggagctcactctgagtggtctcgaggctttctcctttgactat
atggtcaaatggcccttgtcactgattattaacaggaaggcactcacccgctaccagatg
ctcttccgacacatgttctactgcaagcacgtggagcgacagctctgcagtgtctggatc
agcaacaagacagccaagcagcatgcgctgcactccgccaagtggtttgctggtgctttc
acgttgcggcagcgaatgctcaacttcgtccagaatattcagtactacatgatgtttgaa
gtaatggaaccgacctggcacatccttgagaaaaacctgaaatctgcctccaacattgac
gatgtccttggccaccacacaagtttccttgacaactgcctgaaggactgcatgctgacc
aaccctgagctgctgaaggttttctccaagctcatgtccgtgtgcgtcatgttcaccaac
tgtatgcagaaatttacacagagtatgaaactggacagtgaactaggccgtctgacactg
gatcagggtagtgtgcaggggccacccccagagagtgagcggattgatgatcgtccccgg
aaggagcctaccaggaagcacctgcctgagcatgtggacactcctcagctgtcctccggc
ttcgaggccaccatcaacaactttgacaaaaacttctctgcccatcttcttgatttgctg
gcccgactaagtgtctacagcaccagtgactgtgaacacggcatggccagtgtcatctcc
aggctagatttcaatggtttctatgcggaacgcctggaacgtctgtctgcagaaaggagt
cagaaagctgccccccaagtgcctgtcccaaggggacccccagcaccagcatccagggtg
gccattcctgctcaatga

DBGET integrated database retrieval system