KEGG   Rattus norvegicus (rat): 309110
Entry
309110            CDS       T01003                                 

Gene name
Pddc1, RGD1304836
Definition
(RefSeq) Parkinson disease 7 domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DJ-1_PfpI ThiJ_like
Other DBs
NCBI-GeneID: 309110
NCBI-ProteinID: NP_001101033
RGD: 1304836
Ensembl: ENSRNOG00000046382
UniProt: D3ZVI9
Position
1q41
AA seq 220 aa
MASERLPSRPACLLVASGASEGVSAQSFVHCFTLASAAFNLQVATPGGKAMDFVDVTENN
ARWVQDFRLKAYASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKP
ICAIGHGVAALCCATNEDRSWVFQGYSLTGPSVYELIRAPGFARLSLIVEDFVKDSGAGF
SASEPDAVHVVLDRHLVTGQNANSTVPAVQNLLFLCGGRK
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgtcggagaggctgccaagcaggcctgcctgtctcctggtggccagcggcgcttcc
gaaggtgtgtcagcccagtccttcgtccactgtttcacactggccagtgctgccttcaac
ctacaggtggccaccccggggggaaaggccatggactttgtggatgtgacagagaacaat
gcacgttgggtacaagacttccgcctcaaggcatatgccagccctgctaaacttgagtcc
attgacggtgcccggtaccatgccctgctgattcccagctgtcctggcgccctgactgac
ctcgccagcagtgggtccctggctcgaatactgcagcacttccactctgagagcaaaccc
atctgtgccattggccatggtgttgctgccctgtgctgtgctaccaatgaagataggtcc
tgggtgttccagggctacagtctgacagggccttctgtgtatgagctcatcagggcacct
ggctttgcccgcctatcattgatcgttgaggactttgtgaaggactctggggctggcttc
agtgccagtgagcccgatgccgtgcatgtggtgctggatcgccatctggtcactggccag
aatgccaactccactgttcccgctgttcagaacctgctcttcctctgcggcggccggaag
taa

DBGET integrated database retrieval system