KEGG   Rattus norvegicus (rat): 309114
Entry
309114            CDS       T01003                                 

Gene name
Muc5b
Definition
(RefSeq) mucin-5B
  KO
K13908  mucin-5B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    309114 (Muc5b)
  09154 Digestive system
   04970 Salivary secretion
    309114 (Muc5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309114 (Muc5b)
Membrane trafficking [BR:rno04131]
 Others
  Mucins
   Secretory mucins
    309114 (Muc5b)
SSDB
Motif
Pfam: Mucin2_WxxW VWD C8 TIL VWC HRI1
Other DBs
NCBI-GeneID: 309114
NCBI-ProteinID: XP_038957199
RGD: 1561983
Ensembl: ENSRNOG00000019846
Position
1
AA seq 3925 aa
MGGRNWSWALVWASVALLMVWPAESQGQEELSAEHPELTGDSQKVYSAPTSSSARHVTFI
PPISVFPSISALHLAHNGRVCSTWGDFHYKTFDGDVFRFPGLCNYVFSSHCGATYEDFNI
QLRRGLEGSRPTVTYVFLRAQGLVIELSNGSVLVNGHREELPYSRAGLLMEKTSGYVKIS
IRLVLNFLWNEEDSVLLELDSKYTNQTCGLCGDFNGLPAVNEFYAHNTRLTPVQFGNLQK
LDGPTEQCQDVLLSPANNCTDTEGICRHILLGPAFAECIALVDVNVYLDACVQDLCRCPT
CPCATFAEYSRQCAHAGGHPQNWRRSDLCNWTCPFNMEYQECSSPCVDTCSNPQRSQLCE
DHCMDGCFCPPGTVLDDVRHLGCLPLEQCHCTHGGHIYAPGESFNTTCSSCTCFGGLWQC
QDLPCPGTCSVQGGSHISTFDEKLYNVHGDCSYILTKKCADSSFTVLVDLRKCGMTDTEN
CLKAVTLSLNSGDMVVRIQVNGAVFLNSIFTQLPLSAGNVTIFRPSSFFVIVQVGTGLQL
QVQLVPFMQVFVRLDRSYQGQMCGLCGNFNQNQADDFTALSGVVEGTGAAFSNTWKTQAS
CPNSKNTYEDPCSYSVENENFAREWCSMLTESSGVFSACHATVSPVPFYSNCLFDTCNCE
NSEDCMCAALSSYVRACAAKGVLLSGWRGKACYKYMNNCPQTKEYSYSVSTCQPTCRSLS
EVDVTCSIPFVPVDGCTCPEGTFLNDKDHCVPVEECPCYFHGTVVASGEVVMDNGVVCSC
TNGKLTCLGALMQRNKECQAPMVYLDCNNASVGDHGAECLRSCHTLDVDCFSTQCVSGCV
CPSGLVADGNGGCIAEEDCPCVHNEATYRPGEIIRVDCNNCTCRNRRWECTNQPCMGACV
AYGDGHFVTFDGERYIFEGNCEYTLAQDYCRGNTSTDGTFRIVTENVPCGTTGTTCSKAI
KIFVESYELILHEGNFKVVARGPSGDPPYKIRYMGIFLVIEIRSGIVVSWDRKTSVFVRL
QQHYKGRVCGLCGNFDDNAINDFTTRSQSVVGDVLEFGNSWKFSPSCPDAPVPKDPCIAN
PYRKSWAQKKCSIINSATFAACHSQVDSTKYYEACVHDVCACDSGGDCECFCTAVAAYAQ
ACRDVGVCLSWRTPDICPLFCDYYNPHGQCEWHYQPCGAPCLKTCRNPSGHCLVDLPGLE
GCYPQCPPSQPFFNEDQMKCVAQCGCYDDDGNYHDIGTQVPTAENCQSCLCTPGGLQCAY
NLTACTCIYEGRTYNYNDVVYNTTDGLGACLVAICKDNGTIKRTTEECPEVPSTTPFIFT
TTLTPLTTNGSASTASTVCVREVCHWSSWYDESHPEAGMLGGDFETFENLRRKGYQVCQT
PVAIECRAVKFPSLDLEKLGQKVNCDLSSGLRCFNNEQSPPLCHNYELRVLCCDYVPCGS
SLTSGVSTTPSQSDTSKNPSLPTLTTHTASSKSQSWTRGGKETSLDKTHSSRQTVTFASK
SRPTSSPTSSRNSASSLPLSNPTWTTTVKGTNENTVLSSQTTAEFTSHTRSTSSPNTVTQ
TVSSPETSSTTCQPKCEWTKWIDVDYPTSSIDGGDIETYDNIRANGEKVCEKPKDIRCMA
QNYPEEALDNLQQKVKCDVSLGLVCYNRDQGGIFPMCYNYMIKVLCCSVIHCQGSSTTAE
SALTTGTATFTTQTLSSKPHPNTDSVETWSPSGSTTHIDASDLPTPGTLTTSVSSPLTTP
LTVTSVSTQHPKSLESSGIPSVVTIRSTSQGQSLLPSSPHTTNTFSATTSRTSLSSLATI
STSLTTPGPSRTPPGSTTTNPATAASMTRAVTETLSSRPHTETTSEFPGVSSASSTVGPS
TQTGSTSSPSTVIQTVSSPETSSTTCQPKCEWTKWIDVDYPTSSIDGGDIETYDNIRANG
EKVCEKPKDIRCMAQNYPGQALDNLQQKVKCDVSLGLVCYNRDQGGIFPMCYNYMIKVLC
CSVIHCQGSSTTTESAPTMGTATTATSGTSTHTSWPVSSMPTSASTTESFSSREKTTVLT
RASSTATVTSRETQTSSLLTTGPSSALTTTETTSTGCKSQCTWTDWLDSDKPQPGQFGGD
IETYYHIQNKTGIEICKKPVDIECEAILFPNMSFQQLGQEVVCNVDFGLICRNSKQVDNE
TCFNYHIRVLCCEEDISCISTTGSLSTTSTPATGFPSIVPMSTSKWSSEEPKSSTSFTTQ
RRPSTPRTEKIVPNTTTRTTGSFSASSLSTLPASPTSRLQTSKEPHSGKPSTSLWTASSN
VLSTATLTTSIGKPVSGTKTTLWKDLHSSTSTMATSTHPISTTMTTKNPQTLTTNDISKS
NSMLPSRPHITTTSSAPATNRSLATISTSLTTPGPSRTPPGSTTTNPATAASMTRAVTET
PSSRPHTETTSELPGVSSASSTVGPSTQTGSTSSPSTVIQTVSSPETSSTTCQPKCEWTK
WIDVDYPTSSIDGGDIETYDNIRANGEKVCEKPKDIRCMAQNYPGQALDNLQQKVKCDVS
LGLVCYNRDQGGIFPMCYNYMIKVLCCSVIHCQGSSTTTESALTTGTATTAGSVPVTGSA
TTATQTLSPKPLPNTSLTVASTHPASTTVGTSVSKALTGSSHTATLVTSHGTRPPHVSTI
KETSSPGRASSIHTTPKTLPETLQSTSGLTTQQISSTGIWTSVHTGTAGTVSPKSLSTTL
ETTTGIKEPSTSVPMTHTLPPTVTNATTSQGTTHCQPKCKWTEWFDVDSPTSGVVKGDME
TYENIRASGKKMCQAPEKIECRAENYPAVSIDKVGQVVSCNLETGLVCRNEEQTDDFKMC
FNYNIRVLCCDDYSHCPETPYSTIKPSPLWSTPTPLVPFTTSVSSSTESTFQTKHPSSSS
VSSTQASTWTISPDSGCEPRCKWTEWFDADFPNPGPRGGDFEVYAVLREVGFIFCDQPKD
IQCRSEKEPDKPLEALQQVVLCDVRFGLICKNINQSGPLQYCDNYHVRLLCCDNYSHCTT
SPLATTSTVPSSSRLSSTHTAPALNTTTSFPGVSSSSVPHSSSLVSTHTSAVLTTLTSTI
ATGPIVIPSSTSGTPHTPEVFPSSQATFSVSTASSSSVFSTSRPTVISSQASSPSPCFCR
AFGQLFVPGDIIYNKTDGAGCQFYAICNQHCDVDRFQGACPSSSPPTPSTPAPLSPLLPG
CDNITPPRQVNESWTLENCTVAQCQGNNQIILLEPEPVDNVTCVNKHLPIKVWDQEPCHF
HYECECFCSGWGHSHYLTFDGTSYTFVDNCTSVLMREIHPRHGNLSILAHSYYCGATTNV
TFCPRALSVYYNSMEIVLTTTTTNSGKEESLIIWDQMWIRSGFSKNGVTVSLSGATTMSV
NISTIGASITFDGNIFQIWLPYRYFSNNTEGQCGTCTNSQTDDCRRPDGTIASDCQDMAK
DWLVPGNNNSDCLAQPSPSPSTTSQPPMSSTLTSTTCPSAPLCELMLSQVFAECHKFIPP
DAFFRTCVSDHCNGNFSKTLCQSLEVYAALCRIQGVCTDWRNATGGLCDFSCPPSKEYRP
CGPMYPASCSPRTQELSDGTLAEGCFCPEGQLLFNSRTDICVSECPCVGPDGLPKLPGEH
WISNCQDCVCDLGSVSVQCEPVKCEGQDKPPQCTEAGFVTVTWPSTDNPCCPETLCVCNS
TTCPSLPKCEPGYELLQTHENGSCCPISSCRPKLCTYNDTIYGVGATFLGGPCQICTCLS
VDNQEPRVECRETHCTTSCPQGFEYTLVPDQCCGKCVQNACLTPEGQVVQPNETWVNSPG
DNCTTYYCSAENGVHVLTPIPTSCPDVSNCTGILRKTGCCYSCEREDSSTCQVHVNPTVL
RHEGCETEVNITFCEGSCSGKSKYSMEARAIEHQCSCCQETKVHDVAATLQCPDGTVIQH
TYTHIDECKCAPACSSLPMTSMTIS
NT seq 11778 nt   +upstreamnt  +downstreamnt
atgggcggcaggaattggagctgggctctggtctgggcttctgtggccttgctcatggtg
tggccagcagagagccagggccaggaagagctgagcgcagaacatccagaactcaccgga
gacagtcagaaagtgtatagtgcccccacatcctcatccgcacggcatgtcaccttcatc
ccacctatctctgtcttcccaagcataagtgccttacacctggcacacaacgggagagtg
tgcagcacgtggggtgacttccattataagaccttcgatggtgacgtgttccgcttccct
ggcctctgtaactatgtcttctcttcacactgcggggccacctacgaggacttcaacatc
caattacgtcgtggtcttgagggttccaggcccacggtcacctatgtgttcctcagggcc
cagggactggtgattgagctgtctaatggctctgtcctggtaaacggacatcgggaggag
ctgccctacagccgtgcaggtcttctgatggagaagaccagtggctatgtgaagatcagc
atcaggctagtcctcaacttcctgtggaatgaagaagacagtgtcctgctggaactggac
tccaaatacaccaaccagacgtgtgggctgtgcggtgacttcaacgggctcccagctgtc
aatgagttctacgcccacaacactaggctgacccctgtccagtttggaaacctgcagaag
ctggatggtcccacagaacagtgccaggatgtcctactgtcacctgccaacaactgcaca
gatacggagggcatctgccgtcacatcctgcttggccctgcctttgccgagtgcatcgcc
ctggtagacgtcaacgtgtacctggatgcctgtgtccaggacctgtgccgctgccccacc
tgcccatgtgccacttttgctgaatattcccgccagtgtgcccatgcagggggccaccca
cagaactggaggcgttccgatctctgcaactggacctgccctttcaacatggaataccaa
gagtgcagctcaccctgtgtggatacctgctccaacccccagcgctctcaactgtgcgag
gaccactgcatggatggctgcttctgtcccccaggaactgtgctggatgatgtcagacat
ttgggctgcctgcccctggaacagtgccactgtacccacggtggccacatttatgcccct
ggagagtccttcaacaccacctgtagctcctgcacctgcttcgggggactgtggcagtgc
caggacctgccgtgccccggcacctgctctgtgcaaggcgggtcccacatctccaccttt
gatgagaaactctacaatgtgcatggagactgcagctacatcctgaccaagaaatgtgca
gatagcagcttcactgtgctggtggatcttcggaagtgtggaatgacggacaccgagaac
tgcctcaaagcagtgacgctgagcctcaatagcggggacatggtcgtcaggatccaggtc
aacggtgctgtgttcctgaactccattttcactcaactgcccttgtcagcaggcaacgtc
accatcttcaggccatcatccttcttcgttatagtacaggtgggcacggggctgcagctg
caagtgcagctggtgcccttcatgcaggtgtttgtcaggctggaccgctcctaccaaggc
cagatgtgtggcctgtgtggaaacttcaaccagaaccaggccgatgacttcacggccctc
agtggggtggtggagggcacaggggcagccttctccaacacctggaagactcaagcctcc
tgccccaactccaagaacacctatgaagacccctgctcatacagtgtggagaacgagaac
ttcgctcgggagtggtgctcgatgctcactgaaagctcaggagttttctcagcctgccat
gccactgttagcccggtgcccttctactcgaactgcttgtttgacacgtgcaactgtgag
aatagcgaggactgcatgtgtgccgccctgtcctcctacgtgcgtgcctgtgctgccaaa
ggcgtgctgctcagtggctggaggggcaaagcctgctacaagtacatgaacaactgcccc
caaaccaaggagtactcctactcagtgagtacttgccagcctacgtgccgctctctaagt
gaggttgacgtcacctgcagcatcccctttgtgcctgtggatggttgcacctgccctgaa
ggtaccttcctgaatgacaaggaccactgtgtcccagtggaggagtgcccctgctacttc
catggaaccgtggtggcttccggagaggttgttatggacaacggtgtggtgtgctcgtgt
acaaatgggaagttgacctgcctgggagccctgatgcagagaaacaaagagtgccaggca
cctatggtatacttggactgtaacaatgcctcagtgggtgaccacggggctgaatgcctc
agaagctgccacacgctggatgtggattgcttcagcacacaatgtgtctcgggctgcgtg
tgtccctcagggctggtagcagatgggaatgggggctgcattgctgaggaggactgcccc
tgcgtacacaatgaggccacatacagacctggggagatcattcgggtagactgcaataac
tgcacctgccggaaccgccggtgggaatgcaccaaccagccctgcatgggtgcctgtgta
gcctatggggacggccactttgttacctttgatggtgaacgttacatctttgaaggcaac
tgcgagtataccttggctcaagactactgcagaggcaacaccagtactgatgggaccttc
cgtattgtcactgagaatgtcccctgtgggaccacaggaaccacctgctccaaggccatc
aagatctttgtggagagctatgagctgatccttcatgaggggaactttaaggtggtagcg
cgagggccaagtggggaccctccgtacaagatcagatacatgggcatcttcctggtcatt
gagatccggagtgggatagtcgtgtcctgggacaggaagaccagtgtgtttgtccggctg
cagcagcattataagggtagggtctgcggcctgtgtgggaactttgatgacaatgccatc
aatgacttcaccacacgcagccagtctgtggtgggtgatgtgctggagtttggaaatagc
tggaagttctccccatcctgcccggatgccccagttcccaaggatccctgcatcgccaac
ccttaccgcaagtcctgggcccagaaaaaatgtagcatcatcaacagcgcaactttcgct
gcctgccactctcaggttgactctacaaaatactacgaagcctgtgtgcatgatgtgtgt
gcctgtgactcaggaggtgactgtgagtgcttctgcactgccgtggccgcctacgcccag
gcctgccgtgatgtgggtgtgtgcttgtcctggaggactccagacatctgccctcttttc
tgtgactactacaaccctcatgggcaatgtgagtggcattatcagccctgtggagccccc
tgtctgaagacctgtcggaatccatctggacactgcctggttgacctgccaggcctagaa
ggctgctacccacagtgtccacccagccagcccttcttcaatgaagaccagatgaagtgt
gtggcccagtgtggctgctatgatgatgacggaaactatcatgacattggcacacaggtc
cctacagctgagaactgccagagttgtctctgcacccctggtggcctccagtgtgcttac
aaccttacagcctgcacatgcatctatgagggccgtacctacaactacaatgatgttgtc
tacaacaccactgatggcctcggtgcctgcttagtagccatctgcaaagacaacgggact
ataaaacgcacgactgaagagtgccctgaagtcccgtctaccacaccattcatattcacc
accactctgacaccccttaccacaaacggttcagcttccactgcgtctactgtgtgtgtt
cgtgaggtctgccactggtccagttggtatgatgagagccatccagaggctggcatgtta
ggcggggactttgaaacatttgagaacctgaggaggaaagggtaccaggtgtgtcaaacc
cccgttgccattgaatgccgagcagtgaagttccccagcctggacttagagaagctgggt
cagaaggtaaactgtgacctatcctctgggttgagatgcttcaacaatgaacagagcccc
ccactgtgccacaactatgagctgagggttctgtgttgtgattatgtgccctgtggctcc
tctctgacctcgggtgtgagtaccactccctctcagtctgacaccagtaaaaacccctct
ctgcccacacttaccactcatacagcatcctcaaaatcacagtcctggaccagaggtggg
aaagagacatcactggataaaactcacagctcaaggcaaacagtgacgtttgcctcaaag
agcagacctacttcatctcctacgtcatctagaaactcagccagcagcctccccttgtcc
aaccctacctggactacaacagtgaaagggaccaatgagaacacagtgcttagctcccag
acaacagcagaattcacttcacacaccaggtccacttcaagccccaacacagtcacacag
acagtcagcagccctgagacctcctccaccacctgccaacccaaatgtgagtggacaaag
tggattgatgtagactatcctacttctagcattgatggaggagacatagagacatatgac
aatatcagggccaatggagaaaaagtctgtgagaagcctaaggacatcaggtgtatggcc
cagaactaccccgaagaggccttagacaacttgcaacagaaagtgaagtgtgatgtcagc
cttggtctggtgtgctacaaccgggaccagggaggcattttcccgatgtgctacaactac
atgatcaaggtgctctgttgtagtgtcatccactgccagggatcttccaccactgcagag
tcggccctgacgacgggaactgccactttcactacccagaccctgtcctccaagcctcat
cccaacactgattcagttgagacctggtctccctcagggtccaccacccatatagatgct
tcagatttgcccacccctggaaccctgactacaagtgtgtcatccccactcaccacccct
ctcacagtcacttcagtgagcactcagcatcccaagagtctagaatcctctggcatccca
tctgtggtgactatcaggtccacctctcaagggcagtccctgcttcccagcagtccccac
actaccaacacgttctcagcaacaacctcaaggacttccctgtctagcctggccaccatc
tctacctccctgaccactcctggaccctccagaactcctcctgggagcactaccacaaac
ccagccacagctgcctccatgaccagagcggttactgagaccctgtcctcaaggccacat
accgagaccacctcagagttccctggagtttcctcagccagctccacagtagggcccagc
acacagactgggtccacttcaagccccagcacggtcatacagacagtcagcagccctgag
acctcctccaccacctgccaacccaaatgtgagtggacaaagtggattgatgtagactat
cctacctctagcattgatggaggagacatagagacatatgacaatatcagggccaatgga
gaaaaagtctgtgagaagcctaaggacatcaggtgtatggcccagaactaccctggacag
gccttagacaacttgcaacagaaagtgaagtgtgatgtcagccttggtctggtgtgctac
aaccgggaccagggaggcattttcccgatgtgctacaactacatgatcaaggtgctctgt
tgtagtgtcatccactgccagggatcttccaccactacagaatcagccccgacgatggga
actgccactactgccacttctgggacatccacacacacttcctggcctgtgtccagcatg
cctaccagcgccagcactacagagtcattttcttcccgtgaaaaaaccacagtccttacc
agagcttcctctacagctacagtgacatccagggagactcaaacctcatccttgctaacc
actggtccatcctcagccctcacaaccacagagaccacttccacaggctgtaaatctcag
tgcacctggacagattggctggacagtgacaaaccccaacctggccagtttggaggagac
attgagacctactatcatattcaaaacaagacaggtatcgagatatgcaagaaacctgtg
gacattgagtgtgaggccatcctcttccccaacatgtccttccagcaactgggccaggag
gtggtttgtaatgtggacttcggactcatctgtaggaatagcaagcaggtcgacaatgaa
acttgtttcaactaccatatccgtgtcctctgctgtgaggaagatatcagctgtatcagc
acaactgggtcactgtccaccacttccacaccagcaactggatttcccagcatagtcccc
atgtccacaagcaagtggtcatcagaggagccaaaatcctcaacttctttcacaactcaa
aggagaccctctacccctaggacagagaagattgtccccaacaccacgactaggactact
gggagtttctctgcctctagtctctctacacttccagcctctcccaccagccgtctccaa
acctcaaaagagccacactcgggtaagccaagtacaagtttgtggacagcctcctccaat
gttctgagcactgccacgctgaccacctctattggcaaaccggtctctggaacaaaaacc
acattgtggaaagacctccattctagtacctcaaccatggccacatccacccatcccatt
tctaccacaatgacaacgaagaaccctcaaacactgaccaccaatgacatttccaaaagc
aactctatgctgcctagtaggccccatatcaccacaacatcttcagccccagcaacaaat
aggagtctggccaccatctctacctccctgaccactcctggaccctccagaactcctcct
gggagcactaccacaaacccagccacagctgcctccatgaccagagcggttactgagacc
ccgtcctcaaggccacataccgagaccacctcagagctccctggagtttcctcagccagc
tccacagtagggcccagcacacagactgggtccacttcaagccccagcacggtcatacag
acagtcagcagccctgagacctcctccaccacctgccaacccaaatgtgagtggacaaag
tggattgatgtagactatcctacctctagcattgatggaggagacatagagacatatgac
aatatcagggccaatggagaaaaagtctgtgagaagcctaaggacatcaggtgtatggcc
cagaactaccctggacaggccttagacaacttgcaacagaaagtgaagtgtgatgtcagc
cttggtctggtgtgctacaaccgggaccagggaggcattttcccgatgtgctacaactac
atgatcaaggtgctctgttgtagtgtcatccactgccagggatcttccaccactacagag
tcggccctgacgacgggaactgccaccacggcagggtcagtcccagtgacgggatcagca
actactgccactcagaccctgagtcctaagcctcttcccaacactagtctgactgtggcc
agtacccacccagcctccaccacagtaggaacaagcgtctcaaaagctctaacaggctct
agccacacagccactcttgttacatcccatggcacaaggcccccacatgtttcaactatc
aaggaaaccagcagcccgggaagagcctcctcaatccatacaacacccaagaccttgcct
gagacattacagtcgacatctggcttgacaacacaacagatctcgtcaactggaatctgg
acaagtgtacatacgggtacagctggcactgtctccccaaaatctctgtccaccacccta
gaaacgactacaggcataaaagagccatccaccagtgtaccaatgacacataccctacca
ccaaccgtgactaatgcaaccacctcccagggcacaacacactgccagcccaagtgtaag
tggactgaatggtttgatgtggactcaccgacatcgggggtagtaaaaggggacatggag
acctatgaaaacatcagggcctctggcaagaagatgtgccaggcaccagagaaaattgag
tgtcgggcagagaactaccctgcagtgagtattgataaggttggtcaagtagtaagctgc
aacctggagacggggctagtctgcagaaatgaggagcagacagatgattttaaaatgtgc
ttcaactacaatatacgtgtgctttgctgtgatgactatagccactgtcctgaaacccct
tacagcaccatcaagccatccccgctctggtctacccctacgcccctggtccctttcaca
acctcagtgtcctcgagcacggagtccacctttcagactaagcatccctccagctcttcc
gtatcaagcacccaagcctccacatggactatatctcctgactcgggctgtgaacctcgc
tgcaaatggacagagtggtttgacgccgacttccccaaccctggccccagaggcggggac
tttgaggtctacgcagtgcttcgtgaggttggctttatcttctgtgatcaacccaaggac
atccaatgccgttcagagaaggagccagacaagcccctggaagctctacagcaggtggtc
ctgtgtgatgtgcgattcgggctgatatgcaaaaatatcaaccaatcgggacctttgcag
tattgtgacaactaccacgtgcgcctcctctgctgtgacaactatagtcactgtaccacg
tcacctctggccaccacatccactgtcccttcttcctctcgcctgtcctctacccacact
gccccagctttgaataccacgacttctttccctggggtctctagttccagcgtgccccac
tcctcttccctggtatctactcacacctcggcagtgttgaccaccctgacttcaactata
gccactggtcccattgtgatcccctcctcaacctcagggacccctcacacccctgaagtc
ttccccagcagtcaggcgaccttcagcgtgtctactgcttcttcctcctcggtgttcagt
acctccaggcctactgtcatttccagccaagcatcttccccatcaccctgtttctgccgg
gcatttggacagctgttcgtacctggggatatcatctacaataagactgatggagctggc
tgccaattctatgccatctgcaaccagcactgtgatgttgaccgcttccagggtgcctgc
ccctcctcttcacctccaacgccctctacccctgcgcctttgtctcccctgcttcctggc
tgtgataatatcacccctccccggcaggtgaatgagtcttggaccctggagaactgcacg
gtggcccagtgccagggcaacaaccaaatcatcctcctagagccagagcctgtggacaac
gtcacgtgtgtcaacaagcacttgcccatcaaagtgtgggaccaggagccttgccatttc
cactatgagtgtgaatgcttctgcagtggatgggggcactcccactacctgacattcgat
ggcacctcctatacttttgtggacaactgtacctcagtgctcatgagagagatccaccct
cgccatggcaacctgagcatccttgcccacagctactactgtggggccaccacaaatgtc
accttctgtccccgcgccctcagtgtgtactacaactccatggagattgtcctcaccacc
accaccaccaacagtgggaaggaagagagcctgattatatgggaccagatgtggataagg
tcgggcttcagtaagaatggcgtgaccgtatctttgagtggggccaccacaatgagtgtc
aacatttccaccattggcgccagcatcacctttgatggaaacatcttccagatatggttg
ccctatagatacttcagcaacaacactgagggccagtgtggtacctgcacaaacagtcag
acagacgactgccgccggcctgatggcaccatagcttccgactgccaggacatggccaaa
gactggctggtgccggggaacaacaacagcgactgcttagctcaacccagcccttccccc
agcaccacttcccagcccccaatgtccagcacactgacctccaccacatgcccctctgcg
cctctctgtgagctgatgttgagccaggtctttgccgagtgccacaagttcatccctcca
gacgccttcttcagaacctgtgtcagtgaccactgcaatggcaattttagtaaaacgctc
tgtcagagcctggaggtctacgcagcgctctgccggatccagggtgtatgtaccgactgg
cgcaatgccacaggagggctgtgtgacttctcctgtccaccctctaaggagtacaggcct
tgtggacccatgtatccagcttcctgcagccccaggacccaggaactttcagatgggacc
ctggcagagggctgcttctgccctgagggtcagctcctcttcaactcacgcacggacatc
tgtgtgtctgagtgtccctgcgtgggaccagatgggttacccaagcttcctggagaacac
tggatcagcaactgccaggactgtgtgtgtgaccttggctctgtgtcagtacaatgtgag
ccggtgaagtgtgagggccaggacaaacccccacagtgcacagaagctggctttgtgact
gtgacctggcccagcactgacaatccatgctgccctgagacactgtgtgtttgcaattca
accacttgcccgagtctgcccaaatgtgaaccagggtacgaactgctccagacccatgag
aacggcagctgctgtcccatctccagctgtcgacctaagctgtgtacatacaatgacacc
atctatggggtcggtgcaaccttcctagggggtccctgccagatatgcacctgcctctct
gtggacaaccaagaacctagagtagagtgtagggagacccactgcaccacctcttgtccc
cagggctttgagtacacactggtgccagaccagtgctgcgggaagtgtgtacagaatgcc
tgcctcacaccagagggccaggtggtacagcccaatgaaacctgggtgaacagccctggg
gacaactgcactacatactattgtagtgctgagaatggagttcacgtactgaccccaatc
cccacgtcttgccctgatgtgtccaactgtacgggaatcctaaggaaaacgggctgctgt
tactcctgtgaaagagaggactcaagtacctgtcaagtgcacgtcaacccaaccgtcttg
aggcacgagggctgtgagacagaggtcaacatcaccttctgcgagggttcctgctctgga
aagtccaagtactccatggaggcccgggccatagagcatcagtgcagctgctgtcaggag
accaaggtccatgatgtagctgcaacattacagtgtcccgatggtacagtcatccagcac
acctatacccacatcgacgagtgcaaatgtgccccggcctgcagctccctgcctatgact
tccatgactatttcctag

DBGET integrated database retrieval system