KEGG   Rattus norvegicus (rat): 309153
Entry
309153            CDS       T01003                                 

Gene name
Rce1
Definition
(RefSeq) Ras converting CAAX endopeptidase 1
  KO
K08658  prenyl protein peptidase [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    309153 (Rce1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    309153 (Rce1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     309153 (Rce1)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M79: prenyl protease 2 family
   309153 (Rce1)
SSDB
Motif
Pfam: CPBP
Other DBs
NCBI-GeneID: 309153
NCBI-ProteinID: NP_001094055
RGD: 1309261
Ensembl: ENSRNOG00000019468
UniProt: B0BMW8 G3V8J7 Q5M955
Position
1q43
AA seq 329 aa
MAALGGDGLRLLSVSRPERQPESAALSSPGPGLCCWVSVFSCFSLACSYVGSLYVWKSEL
PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL
LLTMILFLGPLMQLCMDCPCDLTDGLKVVLAPRSWARRLTDMRWLRNQVIAPLTEELVFR
ACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGSIFLSAAFQFSYTAVF
GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQKWPLLAGYALGVGLFLLLLQ
PLTDPKLYGSLPLCMLLERTGASETLLCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atggcggcgctgggcggggacgggctgcgtttactgtcggtatcgcggccagagcggcag
cccgagtcagccgcgttgagcagcccgggcccagggctgtgctgctgggtgtctgtgttc
tcctgcttcagcctcgcctgctcctacgtgggcagcctctacgtgtggaagagcgagctg
cccagggaccaccccgctgttatcaagcggcgtttcaccagtgtcctggtagtatcgagc
ttgtccccactttgcgtgctgctctggagggaactcactggcatccagccaggcacatca
ctgcttaccttgatgggcttcaggctggagggcatttttccagcagctctgctgcccctg
ctgctaactatgatccttttcctgggtccactgatgcagctctgtatggattgcccgtgt
gacctgacagatgggctgaaggttgtcctggcccctcgttcttgggcccgccgcctcaca
gacatgcgctggctacgaaaccaagttatagcacccttgacagaggagctggtgttccgg
gcttgtatgctgcccatgctagcaccatgcacaggtctgggccctgctgtgttcacctgc
ccactgttttttggagtcgcccattttcaccacattattgagcagctgcgcttccgccaa
agcagtgtgggaagtatcttcttgtctgcagcgttccagttctcctacaccgctgtcttc
ggtgcttatacggctttcctcttcatccgcacaggacacctgatagggccggttctctgc
cactccttctgcaactacatgggcttccctgctgtgtgtgcagccctggagcatccacag
aagtggccactgctggcgggctatgcccttggtgtgggactcttcctgcttctgcttcaa
cccctgacagaccccaagctctatggcagccttcctctttgtatgcttttggaacgaacg
ggggcctcagagaccctactgtgctcctga

DBGET integrated database retrieval system