KEGG   Rattus norvegicus (rat): 309157
Entry
309157            CDS       T01003                                 

Gene name
Peli3, RGD1305989
Definition
(RefSeq) pellino E3 ubiquitin protein ligase family member 3
  KO
K11964  pellino [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    309157 (Peli3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     309157 (Peli3)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Pellino proteins
    309157 (Peli3)
SSDB
Motif
Pfam: Pellino zf-C3HC4_3 zf-RING_2
Other DBs
NCBI-GeneID: 309157
NCBI-ProteinID: NP_001121014
RGD: 1305989
Ensembl: ENSRNOG00000019950
UniProt: B1WBX1
Position
1q43
AA seq 445 aa
MVLEGNPEVGSPRTSDLQHPGDKGSCILSSPGEEALPGEEPIKYGELIVLGYNGCLSSGD
KGRRRSRLALSRRPHANGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIVEYTH
DSDKDMFQIGRSTENMIDFVVTDTSPGGGTTEGPSAQSTISRYACRILCDRRPPYTARIY
AAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSEDSAPGVWREISVCGN
VYELRDSRSAQQRGKLVENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQE
ANAARPQCPVGLSTLAFPSPARGRTAPDKQQPWVYVRCGHVHGYHGWGCRRERGPQEREC
PLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGHVCSEKTARYWAQTPLPHGTHAFHA
ACPFCGAWLTGELGCVRLIFQGPLD
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggtgctggaaggaaaccctgaagtgggatccccccgaacctcagacctccagcacccg
ggggacaagggctcgtgcatcctctcttctcctggtgaagaagcactgccaggcgaggaa
cccatcaagtatggtgaactcatcgttctgggctacaatgggtgtctgtcaagtggggac
aagggccgccgccgaagccgcctggcactgagccgccggccacatgccaacggagtgaag
ccagatgtcatgcaccacatctccacaccactcgtctccaaggccctgagtaaccgaggc
cagcatagcatctcatacacactgtcccggagccactccgtcatagtggagtacacacat
gacagcgacaaagacatgttccagattggccgctctactgaaaacatgattgacttcgtg
gtaacggacacatctcctggcggagggactacggagggcccttctgcccagagtaccatc
tctcgctatgcctgccgaatcctctgtgaccgccggccaccctatactgcccgcatttat
gctgctggttttgatgcctctagcaacatctttcttggagagcgggcagccaagtggagg
actcctgacggtctgatggatggcttgacaaccaatggggtcctggtgatgcacccagcg
ggtggcttctctgaggactctgccccgggtgtctggagggaaatttccgtttgcgggaat
gtgtacgaacttcgggatagccgatcagctcagcagcgggggaagctggtggaaaacgaa
tccaacgtcctgcaagatggttcgctcatcgacctgtgtggggccacactgttgtggcgc
actccggcagggttgctgagggcacccaccctgaaacaactggaggcccagcgacaggag
gccaacgcagcacggccccagtgtcctgtgggcctcagcaccttggccttccccagtcca
gcccgtggccgcacagcacccgacaagcagcaaccctgggtctacgtccgttgtggtcac
gtccatggctatcatggctggggctgccggagggagcgaggcccccaggagcgcgagtgt
cctctctgccgccttgtgggaccctatgtgcccctgtggctcggccaggaggccggtctc
tgcctggaccctgggccacccagccacgcttttgcgccctgtggccacgtctgttctgag
aagactgcccgctattgggcccagacaccactgccgcatggcacccatgctttccatgcg
gcctgccccttttgtggggcttggctcactggagagcttggctgtgtccgcctaattttc
caggggccactggactag

DBGET integrated database retrieval system