KEGG   Rattus norvegicus (rat): 309255Help
Entry
309255            CDS       T01003                                 

Gene name
Mtmr10, RGD1305958
Definition
(RefSeq) myotubularin related protein 10
  KO
K18085  myotubularin-related protein 10/11/12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    309255 (Mtmr10)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    309255 (Mtmr10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related 3-PAP
Motif
Other DBs
NCBI-GeneID: 309255
NCBI-ProteinID: NP_001094316
RGD: 1305958
Ensembl: ENSRNOG00000016090
UniProt: G3V810
Position
1q22
AA seq 771 aa AA seqDB search
MFSLKPPRPSFRSYLLPPPQTDDKISSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSANKVNGVSSGGGGVWSGAGSPSSQRTPLFETYSDWDRETKRTGASGWRVCSI
NEGYMISTCLPEYFVVPSSLADQDLKIFSPSFVGRRMPCWCWSHSNGSALVRMALIKDVL
QQRKIDQRICNAITKSHPQRSDVYKSDLDKTLPNIQEIQAAFVKLKQLCVNEPFEETEEK
WLSSLESTRWLEYVRAFLKHSAELVYILESQRLSVVLQEEEGRDLSCLVASLVQVMMDPY
FRTITGFQSLVQKEWVMAGYPFLDRCNHLKRSEKESPLFLLFLDTTWQLLEQYPAAFEFS
ETYLAVLCDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDWSLQF
TAKDRTLFHNPYYIGKSTPCIQNGSRKSFKRTKKSYSSTLRGMPSCLKNGLISDQELLPR
RNSLILKLKPDPPQHGDSQHSGAEQYFKEWFSRPANLHGIILPRLSGTHIKLWKLCYFRW
VPEAQINLGGSIMAFHKLSVLADEVDKLSRMLRQHHSGPLEACYAELDQSRMYFRATGPH
DTLGTPEFLSSSFPFSPVGNLCRRSILGTPLSKFLSGAKIWLSTETLANED
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgttctctctcaagccgcccagacccagcttcaggtcctacctcctgccgccgccccag
actgacgataagatcagttccgaaccgaagattaaaaaactggagccagttcttttgcca
ggagaaattgttgtaaatgaagtcaattttgtgagaaaatgcattgcaacagacacgagc
cagtatgatttatggggaaagttgatatgcagtaacttcaaaatttcctttattacagat
gacccaatgccattacagaaattccattacagaaaccttctccttggagagcatgatgtc
cctttgacttgtattgaacagattgtcacagtgaatgaccacaagaggaaacagaaagtc
ctaggtcccaaccagaagctgaaattcaatccaacagaattaattatttattgtaaagat
ttccgaattgtcagatttcgctttgatgagtcgggtcctgaaagtgctaagaaggtatgc
cttgcaatagctcattattcccagccaacagacctgcagctactctttgcatttgaatat
gttgggaaaaaataccacaattcagccaacaaagttaatggagtatcctcaggaggtgga
ggagtatggagtggagctggcagtcccagcagccagaggacgccgctgttcgaaacttac
tcagattgggacagagagaccaagaggacaggcgcttctgggtggagagtttgttctatc
aatgaaggttacatgatatctacttgccttccagaatactttgtcgtgccaagttcacta
gcagaccaagacctgaagatcttttctccttcttttgttggaagaagaatgccatgctgg
tgctggagccattccaacggcagtgctcttgtgcgaatggctctcatcaaagatgtgctg
cagcagaggaagatcgaccagaggatttgcaatgctataactaaaagtcatccacagaga
agtgatgtttacaagtcagatttggataagactttgcccaatatccaagaaatacaagcg
gcatttgtaaaacttaagcaactgtgtgtcaatgagccttttgaagaaactgaagagaag
tggttgtcttcactggaaagtactcggtggttagaatatgtcagggctttccttaaacac
tcagctgaacttgtgtacattcttgaaagccagcgtctctctgtagtcctgcaagaggag
gaaggcagagacttgagttgtctggtggcgtctcttgttcaagtgatgatggatccatac
ttcaggacaattactggatttcagagtctggtacagaaggagtgggtcatggcagggtac
ccgttcctagacagatgtaaccatttgaagaggtcagagaaagagtctcctttgttcttg
ctgttcttggataccacgtggcagctgctagagcagtatccagctgccttcgagttctcc
gagacgtacttagcagtactgtgtgacagtacccggatctcgctgttcgggaccttcctg
ttcaactctcctcatcagcgggtgaagcagagcacagagtttgctatcagcaaaaacatt
cagctgggtgatgaaaagggcttgaaattcccctcagtttgggactggtctcttcagttc
acggcgaaggaccgtactcttttccacaacccctactacattggcaagagtactccttgc
atacagaatggctccaggaagtcttttaagcgcacaaagaaaagctacagctccacactg
agaggaatgccctcatgcttgaagaatggactcatcagtgaccaagaactgcttccgcgg
agaaactcactgatattgaagttgaagccagacccgcctcagcacggcgacagccagcac
agtggagcagagcagtattttaaagagtggttttccagaccagccaatctacacggcatt
atcctgccacgtctctctggaacacacataaaattgtggaaactgtgttacttccgctgg
gtccctgaggcccagatcaaccttgggggctccatcatggccttccacaagctgtctgtc
ctggctgacgaggtggacaagctcagcaggatgctgaggcagcatcacagcggcccctta
gaagcctgctacgcagagttggaccagagcaggatgtactttagggccacagggccacat
gacacgctagggacaccagagttcctctcctcttcatttccattttctcctgtaggaaat
ctgtgcagacgaagcattttaggaacaccattaagcaaatttttaagtggggccaaaata
tggttatctactgagacactagcaaatgaagactaa

DBGET integrated database retrieval system