KEGG   Rattus norvegicus (rat): 309256
Entry
309256            CDS       T01003                                 

Gene name
Fan1, Mtmr15, RGD1566323
Definition
(RefSeq) FANCD2 and FANCI associated nuclease 1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    309256 (Fan1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    309256 (Fan1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     309256 (Fan1)
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     309256 (Fan1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     309256 (Fan1)
SSDB
Motif
Pfam: VRR_NUC DUF4363 zf-TRAF DUF1771 Plasmodium_Vir
Other DBs
NCBI-GeneID: 309256
NCBI-ProteinID: NP_001178562
RGD: 1566323
Ensembl: ENSRNOG00000023985
UniProt: D3ZVU2
Position
1q22
AA seq 1020 aa
MMSQKSSPAQKRPRKSLSTGKTTKSQSHSITSYFNSVPPAKLACSICHKMVPRYDLIRHL
DESCANNGEIVQNEPAQAGLINSTVPTSDLPSTPLEDMTPQKLSPPKRRLISAQCGSKLG
VRQQTSPYFKKALVCKNQNKLPNQSVEIRSLGSLSSKLSRRYVKAKKSLSKNEGLASHCP
PTSPSPPGPSLVDNCPEMDNKDEILNSSQKENIYSCAPLEEETASEQKVKSSKRMGDGSQ
KASGGEPALTPASPEQAPTLLSSDLTLVNNTDSSSGDALEQEGAGRVGVGVDEQLAACSH
EEVQMTVDAEVGTLVSGGAESNSPADNDDDDASTWSNNPELREAGSALKRQRACSPLEQG
ASCVPSVTAQPQPSHPYYLRSFLVVLQAILENEEDMKLFDDQEKGVIAKFYQLSASGQKL
YVRLFQRKLTWIKVSKLEYEEIASDLTPVVEELKNLGFLQTESELQELSDVLELLSAPEL
KALAKTFHLVSPGGQKQQLVDAFLKLARQRSVYTWGKTQPGIRAVILKRAKDLAGPSLRV
CKGPRAVFCRLLLLFSLTDTMEDEEAACGGQGQLSTVLLVNLGRMEFPQYSISRKTQIFR
DREDLIRYAAAAHMLSDISAAMASGNWEEAKELSQIAKRDWDQLKSHPSLRYHEALPLFL
RCFTVGWIYTRISSRAVEVLERLHMYEEAVKELENLLAQKVYCPDSRGRWWDRLALNLHQ
HLKRLEEAIWCIKEGLADPQVRTGHRLSLYQRAVRLRESPSCKKYRHLFSQLPEVTVGDV
KHVTITGRLCPQHGMGKSVFVIEGGDPTNPTTILCSVEELALDYYRRSGFDQGIHGEGST
FSTLCGLLLWDIIFMDGIPDVFRNAYQASPLDLLTDSFFSSREQALEARLQLIHSAPAES
LRAWVTEAWQAQQGRAASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRRLAADFRHCRGG
LPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLDELQKLGADVEVCHVVAVGAKSKGLG
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgatgtcacaaaagagctcacctgctcaaaaaagaccccgtaaaagcttatctaccggc
aaaactacgaaaagccaatctcattccattacttcgtattttaacagtgtaccacctgct
aaacttgcatgttcaatttgtcataaaatggtgcccaggtatgacttaatccggcacctt
gatgagtcttgtgctaacaatggtgaaatcgttcaaaatgagcctgctcaggctggttta
attaactcaactgtgcctacatcagatttacccagtactcctttagaagatatgacacct
cagaagttatcaccaccaaagagacgtttaatctctgcccagtgtggttcaaaactgggc
gtgcgacagcagaccagtccctactttaaaaaagccttggtgtgcaaaaatcaaaataag
cttccaaatcagagtgtggaaatcaggtctttgggaagtctgtcatcaaaactgtccaga
aggtacgtaaaagctaaaaaatcactctctaagaacgaggggctagccagtcattgccca
ccgacttctccgtccccacctggccccagcctggttgataactgtccagagatggacaac
aaagatgagattttaaacagttcccagaaggaaaacatttactcgtgtgcacctctagag
gaagagaccgcttcagaacagaaggtaaagagcagtaaaaggatgggagatggaagtcag
aaagcttccggtggggagccggccctcacgcctgcatccccagagcaggcccccacatta
ctgtcctcagacttaactcttgtcaataacacggattcctcttcgggagatgctctcgaa
caagaaggtgctggaagggtaggtgtaggggttgatgaacagcttgcggcatgcagccat
gaagaagtacaaatgactgttgatgctgaggtgggaacgctggtgtcagggggggcggaa
tcaaacagtcctgctgacaacgacgacgatgacgcatctacatggagtaacaacccagag
cttagggaagctggcagtgccttaaagagacaaagggcttgcagtcctctggagcagggc
gccagttgtgttcccagtgtgacagctcaaccccaaccgagtcacccgtactacctgagg
agcttcctggtggttctgcaggccatccttgagaacgaagaggacatgaagctcttcgat
gaccaggagaagggcgttatagctaagttttaccagctgtcagccagtggtcagaagttg
tatgtgaggctcttccaacgtaaattaacctggattaaagtgagtaaactggagtatgaa
gagattgcctcggacttaacccctgtggttgaagaattgaagaacttaggctttctacag
acagaatctgagttgcaagaactctctgatgtacttgaactcctttctgctcctgagctg
aaagccctggccaaaaccttccacttggtgagtcccggtgggcagaagcagcagctggta
gacgccttcctcaaactggccagacagcgctcagtctacacttggggcaagactcagcct
ggaatcagagcggtgattttaaagagagctaaagacttggctggcccgtcccttcgagtc
tgtaaaggccctagggctgtgttttgccgcctcctgcttctgttctcgttgactgatacc
atggaagacgaagaagctgcgtgtgggggtcaaggtcagctgtctactgtgctattggtc
aatctgggccgaatggagtttcctcagtacagcatcagccggaagacccagatcttcagg
gacagagaggatcttatcagatacgcagccgccgcgcacatgctgagtgacatctcagct
gccatggccagtgggaactgggaagaagctaaggagctttctcagattgcaaagagagac
tgggaccaactgaaaagccacccttccctgagataccacgaggccttgccactctttctg
cgctgttttactgttgggtggatctacacaaggatttcctctcgggctgttgaagtacta
gagagacttcacatgtacgaggaagctgtcaaggaacttgaaaacctcctcgctcagaaa
gtctattgtcctgacagcagaggccgctggtgggaccgcctggctcttaacctgcaccag
cacctgaagcgtctggaagaggcaatttggtgcatcaaggaaggcctggcagatccacaa
gtgaggacaggacaccgactttctctttatcagcgagctgtgcgccttcgagagtctccg
agctgtaaaaagtacaggcacctattcagccagctgccagaagtcactgtgggagacgtt
aagcatgtgaccatcacaggcaggctgtgcccacagcatgggatgggcaagtctgtgttt
gtcattgagggtggagaccccaccaaccccaccacaatcctgtgttctgtggaggaactg
gcactggactattacaggcggagtggctttgaccaagggattcacggagaagggtccacc
ttcagcaccctgtgtggcctcctgctgtgggatatcatcttcatggatggaataccagat
gtcttcagaaatgcctaccaggcctcccccctggatttgctcacagacagcttcttctca
agcagggagcaggccctggaagccaggctgcagctgatccacagcgcccctgctgagagc
ctgcgggcctgggtgactgaagcatggcaggcccagcaaggcagggcggcttctctggtc
agctgggatcgcttcacttcccttcagcaagctcaggaccttgtctcctgcctcgggggt
cctgtcctcagcggtgtgtgcaggcgcctggctgctgactttcggcactgccgaggaggc
ctccctgatttggtggtgtggaattctcagagccaccattgcaagctggtggaagttaaa
ggccccagtgatcgcctgtcatgtaagcagatgatctggctggatgaactacaaaagctg
ggggcagacgtagaagtatgccatgtggttgcagttggtgctaagagcaaaggtcttggc
tga

DBGET integrated database retrieval system