KEGG   Rattus norvegicus (rat): 309288Help
Entry
309288            CDS       T01003                                 

Gene name
Rorb
Definition
(RefSeq) RAR-related orphan receptor B
  KO
K08533  RAR-related orphan receptor beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    309288 (Rorb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    309288 (Rorb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    309288 (Rorb)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    309288 (Rorb)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   309288 (Rorb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 309288
NCBI-ProteinID: NP_001257887
RGD: 1306778
Ensembl: ENSRNOG00000013413
UniProt: A0A0G2JX88
Structure
PDB: 

Position
1q43
AA seq 459 aa AA seqDB search
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR
VYSSSISNGLSNLNTETGGTYANGHVIDLPKSEGYYNIDSGQPSPDQSGLDMTGIKQIKQ
EPIYDLTSVPNLFTYSSFNNGQLAPGITMSEIDRIAQNIIKSHLETCQYTMEELHQLAWQ
THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL
EVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA
LFSSAVLISPDRAWLLEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
NLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDCAAVCK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcacaaattgaagtgataccatgcaaaatttgtggcgataaatcctccgggatc
cactacggagtcatcacgtgtgaaggctgcaagggattcttcaggaggagccagcagaac
aatgcctcttactcctgcccaaggcagagaaactgtttaattgacagaaccaacaggaac
cgttgccaacactgccgcctgcagaagtgtcttgccctaggaatgtcaagagatgctgtg
aagtttgggaggatgtccaagaagcagcgggacagcctgtatgctgaggtgcagaagcat
cagcagaggctgcaggagcagcggcagcagcagagtggggaggcagaggcccttgccagg
gtgtacagcagcagcattagcaatggcctcagcaacctgaacaccgagaccggcggcaca
tacgccaacgggcacgtcattgacctgcccaagtccgagggttactacaacatagattcc
ggtcaaccgtctcccgatcagtcaggactggacatgactggaatcaaacagataaagcaa
gaacctatctatgacctcacatccgtacccaacttgtttacctatagctctttcaacaac
gggcagttagctcccgggataacaatgtctgagatcgatcgaattgcacagaacatcatt
aagtcccatttggagacgtgccagtacacaatggaagagctccatcagctggcatggcag
acccacacctatgaggaaataaaggcatatcaaagcaagtccagggaggctctgtggcag
cagtgtgccatccagatcacccacgccatccaatatgtggtggagttcgcaaagcggata
acaggcttcatggagctgtgtcagaacgatcagatcttacttctgaagtcaggttgcttg
gaagtggttttagtgagaatgtgccgtgccttcaacccattaaacaacactgttctgttt
gaaggaaaatatggaggaatgcaaatgttcaaagccttaggttctgatgacctagtgaat
gaagcatttgactttgcgaagaatctgtgttccttgcagctgaccgaggaagagattgct
ctgttctcctctgctgttctgatatccccagaccgagcctggctgttagaaccaagaaaa
gtccagaagcttcaggaaaaaatttattttgcacttcaacatgtgattcagaagaatcac
ctggatgatgagaccctggcaaagttaatagccaagataccaactatcacggcagtctgc
aacttgcatggggagaagctacaggtatttaagcagtctcatccagacatagtgaataca
ctgtttcctccattgtacaaggagctctttaatcctgactgtgctgcggtctgcaaatga

DBGET integrated database retrieval system