KEGG   Rattus norvegicus (rat): 309295
Entry
309295            CDS       T01003                                 

Gene name
Ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04668  TNF signaling pathway
rno04920  Adipocytokine signaling pathway
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05212  Pancreatic cancer
rno05215  Prostate cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05340  Primary immunodeficiency
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    309295 (Ikbkg)
   04014 Ras signaling pathway
    309295 (Ikbkg)
   04064 NF-kappa B signaling pathway
    309295 (Ikbkg)
   04668 TNF signaling pathway
    309295 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    309295 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    309295 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    309295 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    309295 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    309295 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    309295 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    309295 (Ikbkg)
   04660 T cell receptor signaling pathway
    309295 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    309295 (Ikbkg)
   04659 Th17 cell differentiation
    309295 (Ikbkg)
   04657 IL-17 signaling pathway
    309295 (Ikbkg)
   04662 B cell receptor signaling pathway
    309295 (Ikbkg)
   04062 Chemokine signaling pathway
    309295 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    309295 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    309295 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    309295 (Ikbkg)
   05203 Viral carcinogenesis
    309295 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    309295 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    309295 (Ikbkg)
   05221 Acute myeloid leukemia
    309295 (Ikbkg)
   05220 Chronic myeloid leukemia
    309295 (Ikbkg)
   05215 Prostate cancer
    309295 (Ikbkg)
   05222 Small cell lung cancer
    309295 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309295 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    309295 (Ikbkg)
   05161 Hepatitis B
    309295 (Ikbkg)
   05160 Hepatitis C
    309295 (Ikbkg)
   05171 Coronavirus disease - COVID-19
    309295 (Ikbkg)
   05164 Influenza A
    309295 (Ikbkg)
   05162 Measles
    309295 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    309295 (Ikbkg)
   05163 Human cytomegalovirus infection
    309295 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    309295 (Ikbkg)
   05169 Epstein-Barr virus infection
    309295 (Ikbkg)
   05165 Human papillomavirus infection
    309295 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    309295 (Ikbkg)
   05135 Yersinia infection
    309295 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    309295 (Ikbkg)
   05142 Chagas disease
    309295 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    309295 (Ikbkg)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    309295 (Ikbkg)
   05418 Fluid shear stress and atherosclerosis
    309295 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    309295 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    309295 (Ikbkg)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   309295 (Ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 ERM DpnI_C
Other DBs
NCBI-GeneID: 309295
NCBI-ProteinID: NP_954534
RGD: 735223
Ensembl: ENSRNOG00000060936
UniProt: Q6TMG5
Position
X
AA seq 412 aa
MSRHLWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRRQREQ
ALEDLEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQTLEGRIRAVSEQ
VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQD
YDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADI
YKADFQAERHAREKLVERKELLQEQLEQLQREFNKLKVGCHESARIEDMRKRHVETSQPP
LLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagcaggcacctctggaagaatcagttgagtgagatggtgcaacccagtggtggccca
gcagaggaccaggacatgctgggtgaagaatcttctctggggaagccagcaatgctacat
cttccttcagagcagggtactcctgagaccctccagcgctgtctggaagagaatcaagaa
ctccgagatgctatccggcagagcaatcagatgctgagggaacgctgtgaggagctgctg
catttccaggtcagccagcgggaggagaaggagttcctcatgtgcaaattccaggaagcc
aggaagctggtggagagactgagcttggagaagcttgacctgcggaggcagagagaacag
gccttagaggatttggagcatctgaagaaatgccaacagcagatggctgaggacaaggcc
tctgtgaaagctcaggtgacatcattgctgggggaactccaggagagccagagtcgtttg
gaggctgctaccaaggaacgacaaactttagagggaaggattcgagcagttagtgagcag
gtcagacagctggagagtgagcgggaggtgctgcagcagcagcacagtgtccaggtggac
caactgcgcatgcagaaccagagtgtggaggctgccttgcgaatggagcgacaggctgct
tcagaggagaagcggaagctggctcagttgcaggcagcctatcaccaactcttccaagac
tatgacagccacattaagagcagcaagggcatgcagctggaagatctgaggcagcagctc
cagcaagctgaggaggccctggtagccaaacaggaattgattgataagctgaaagaggaa
gctgagcagcacaagattgtcatggagaccgttccagtcttgaaagcccaggcggacatc
tacaaggctgacttccaagctgagaggcatgcccgggagaaactggtggagaggaaggag
cttttgcaggagcagttggagcagctgcagcgcgagttcaacaagttgaaagttggctgc
catgagtcagccaggattgaggatatgaggaagcggcatgtagagacttcccagccccct
ttactccctgctccagctcaccactcctttcatttggccttgtccaaccagcggaggagc
cctcctgaggaaccacctgacttctgttgtcccaagtgccagtatcaggctcctgatatg
gacactctacagatacatgtcatggagtgcatagagtag

KEGG   Rattus norvegicus (rat): 309361
Entry
309361            CDS       T01003                                 

Gene name
Chuk
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04068  FoxO signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04668  TNF signaling pathway
rno04920  Adipocytokine signaling pathway
rno05010  Alzheimer disease
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05212  Pancreatic cancer
rno05215  Prostate cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    309361 (Chuk)
   04014 Ras signaling pathway
    309361 (Chuk)
   04064 NF-kappa B signaling pathway
    309361 (Chuk)
   04668 TNF signaling pathway
    309361 (Chuk)
   04068 FoxO signaling pathway
    309361 (Chuk)
   04151 PI3K-Akt signaling pathway
    309361 (Chuk)
   04150 mTOR signaling pathway
    309361 (Chuk)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    309361 (Chuk)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    309361 (Chuk)
   04621 NOD-like receptor signaling pathway
    309361 (Chuk)
   04622 RIG-I-like receptor signaling pathway
    309361 (Chuk)
   04623 Cytosolic DNA-sensing pathway
    309361 (Chuk)
   04625 C-type lectin receptor signaling pathway
    309361 (Chuk)
   04660 T cell receptor signaling pathway
    309361 (Chuk)
   04658 Th1 and Th2 cell differentiation
    309361 (Chuk)
   04659 Th17 cell differentiation
    309361 (Chuk)
   04657 IL-17 signaling pathway
    309361 (Chuk)
   04662 B cell receptor signaling pathway
    309361 (Chuk)
   04062 Chemokine signaling pathway
    309361 (Chuk)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    309361 (Chuk)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    309361 (Chuk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    309361 (Chuk)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    309361 (Chuk)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    309361 (Chuk)
   05221 Acute myeloid leukemia
    309361 (Chuk)
   05220 Chronic myeloid leukemia
    309361 (Chuk)
   05215 Prostate cancer
    309361 (Chuk)
   05222 Small cell lung cancer
    309361 (Chuk)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309361 (Chuk)
   05170 Human immunodeficiency virus 1 infection
    309361 (Chuk)
   05161 Hepatitis B
    309361 (Chuk)
   05160 Hepatitis C
    309361 (Chuk)
   05171 Coronavirus disease - COVID-19
    309361 (Chuk)
   05164 Influenza A
    309361 (Chuk)
   05162 Measles
    309361 (Chuk)
   05168 Herpes simplex virus 1 infection
    309361 (Chuk)
   05163 Human cytomegalovirus infection
    309361 (Chuk)
   05167 Kaposi sarcoma-associated herpesvirus infection
    309361 (Chuk)
   05169 Epstein-Barr virus infection
    309361 (Chuk)
   05165 Human papillomavirus infection
    309361 (Chuk)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    309361 (Chuk)
   05135 Yersinia infection
    309361 (Chuk)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    309361 (Chuk)
   05142 Chagas disease
    309361 (Chuk)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    309361 (Chuk)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    309361 (Chuk)
   05418 Fluid shear stress and atherosclerosis
    309361 (Chuk)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    309361 (Chuk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    309361 (Chuk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     309361 (Chuk)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   309361 (Chuk)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 309361
NCBI-ProteinID: NP_001101058
RGD: 1306661
Ensembl: ENSRNOG00000022485
UniProt: G3V926
Position
1
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVSLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNNLCSLIVEPMESWLQLMLNWDPQQRGGPIDPPLKQPKC
FVLMDNILNLKIVHILNMTSAKIISFLLPYDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPV
TQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFRKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYSEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPTDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGTVTPPVSAWLPPTLADREHPLTCVVTPQDGETLAQMIEENLNCLGHL
STIIREANEDQSSSMMSLDWSWLAE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggcctggcgccggcggcccctgggagatgcgggagagg
cttggcaccggcggcttcgggaacgtcagtctgtaccagcaccgggaacttgatctcaaa
atagcaattaagtcttgtcgcttagagctaagtaccaaaaacagagaacgatggtgccat
gaaatccagatcatgaaaaagttgaaccatgcaaatgttgtaaaggcctgtgatgttcct
gaggaattgaattttttaattaacgatgtgcctcttctagcaatggagtactgttctgga
ggggacctccggaagctactcaacaaaccagaaaattgttgtggacttaaagagagccag
atcctttctttactgagtgacataggatctgggattcgttatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaatatagtgcttcaagatgttggtgggaagataatg
cataaaataattgatttgggttatgccaaagatgtcgatcaaggaagtctctgtacatct
tttgtgggaacattacagtatttggccccagagctctttgaaaataagccatacacagcc
actgtggattattggagctttgggaccatggtgtttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgaaaagattaagaagaaagatccaaag
tgtatatttgcttgtgaagagatgaccggagaagttcggtttagtagccatttacctcag
ccaaacaacctttgtagtttaatagtagagccaatggaaagctggctacagttgatgctg
aattgggacccacagcagagagggggacctattgaccctcctttgaagcagccaaaatgc
tttgtgttaatggataacatcctcaacttgaagatagtgcacatcctaaatatgacttct
gcaaaaatcatttcttttctgttaccatatgatgaaagtctccattcactacagtctcga
attgagcgtgaaacaggaataaatacaggttctcaagaacttctgtcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagtgagaggctgtgat
agctacatggtttatttgtttgataaaagtaagactgtatatgaaggaccatttgcatcc
agaagtttatctgattgtgtaaattatattgtgcaagacagcaagatacagcttccagtt
acacagcttcgcaaagtgtgggctgaagcagtgcactatgtatctgggctaaaggaggac
tacagcaggctctttcagggacaaagagcagcaatgttaagtcttcttagatataatgct
aacttgacaaaaatgaagaatactttgatctcagcatcacagcaactcaaagctaaattg
gagttttttcgcaaaagcattcagcttgacttggagagatatagtgagcagatgacttat
gggatatcttcagaaaaaatgctgaaagcatggaaagaaatggaagaaaaggccattcac
tattctgaggttggtgtcattggataccttgaggatcaaattatgtctttgcacactgaa
atcatggagctgcagaagagcccctatgggagacgccagggagacctgatggaatccctg
gaacagcgtgccattgatctctataagcagctaaaacacagacccaccgatcactcctac
agtgacagcacggagatggtgaagatcattgtgcacactgtgcagagtcaggaccgagtt
ctcaaggagctgtttggtcacctgagcaagttgttgggctgcaagcagaagattattgat
ctactccccaaggtggaagtggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatttggcacctccttaaaattgcttgtacacag
agttctgctcgctctcttgtaggatccagtctagaaggcacagtaacccctccagtatca
gcatggctgccccctactctagcagaccgtgaacatcctctgacatgtgtggtaactcct
caagatggcgagacgttagcacaaatgatagaagaaaatctgaactgtcttggccattta
agtactattattcgtgaagcaaatgaggaccagagcagtagtatgatgagtcttgattgg
agttggttagcagaatga

KEGG   Rattus norvegicus (rat): 84351
Entry
84351             CDS       T01003                                 

Gene name
Ikbkb
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04068  FoxO signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05212  Pancreatic cancer
rno05215  Prostate cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    84351 (Ikbkb)
   04014 Ras signaling pathway
    84351 (Ikbkb)
   04064 NF-kappa B signaling pathway
    84351 (Ikbkb)
   04668 TNF signaling pathway
    84351 (Ikbkb)
   04068 FoxO signaling pathway
    84351 (Ikbkb)
   04151 PI3K-Akt signaling pathway
    84351 (Ikbkb)
   04150 mTOR signaling pathway
    84351 (Ikbkb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    84351 (Ikbkb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    84351 (Ikbkb)
   04621 NOD-like receptor signaling pathway
    84351 (Ikbkb)
   04622 RIG-I-like receptor signaling pathway
    84351 (Ikbkb)
   04623 Cytosolic DNA-sensing pathway
    84351 (Ikbkb)
   04625 C-type lectin receptor signaling pathway
    84351 (Ikbkb)
   04660 T cell receptor signaling pathway
    84351 (Ikbkb)
   04658 Th1 and Th2 cell differentiation
    84351 (Ikbkb)
   04659 Th17 cell differentiation
    84351 (Ikbkb)
   04657 IL-17 signaling pathway
    84351 (Ikbkb)
   04662 B cell receptor signaling pathway
    84351 (Ikbkb)
   04062 Chemokine signaling pathway
    84351 (Ikbkb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    84351 (Ikbkb)
   04920 Adipocytokine signaling pathway
    84351 (Ikbkb)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    84351 (Ikbkb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    84351 (Ikbkb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84351 (Ikbkb)
   05206 MicroRNAs in cancer
    84351 (Ikbkb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    84351 (Ikbkb)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    84351 (Ikbkb)
   05221 Acute myeloid leukemia
    84351 (Ikbkb)
   05220 Chronic myeloid leukemia
    84351 (Ikbkb)
   05215 Prostate cancer
    84351 (Ikbkb)
   05222 Small cell lung cancer
    84351 (Ikbkb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    84351 (Ikbkb)
   05170 Human immunodeficiency virus 1 infection
    84351 (Ikbkb)
   05161 Hepatitis B
    84351 (Ikbkb)
   05160 Hepatitis C
    84351 (Ikbkb)
   05171 Coronavirus disease - COVID-19
    84351 (Ikbkb)
   05164 Influenza A
    84351 (Ikbkb)
   05162 Measles
    84351 (Ikbkb)
   05168 Herpes simplex virus 1 infection
    84351 (Ikbkb)
   05163 Human cytomegalovirus infection
    84351 (Ikbkb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    84351 (Ikbkb)
   05169 Epstein-Barr virus infection
    84351 (Ikbkb)
   05165 Human papillomavirus infection
    84351 (Ikbkb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    84351 (Ikbkb)
   05135 Yersinia infection
    84351 (Ikbkb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    84351 (Ikbkb)
   05142 Chagas disease
    84351 (Ikbkb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84351 (Ikbkb)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    84351 (Ikbkb)
   05418 Fluid shear stress and atherosclerosis
    84351 (Ikbkb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    84351 (Ikbkb)
   04932 Non-alcoholic fatty liver disease
    84351 (Ikbkb)
   04931 Insulin resistance
    84351 (Ikbkb)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    84351 (Ikbkb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    84351 (Ikbkb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     84351 (Ikbkb)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   84351 (Ikbkb)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH YrbL-PhoP_reg Glyco_hydro_65m ubiquitin
Other DBs
NCBI-GeneID: 84351
NCBI-ProteinID: NP_445807
RGD: 621375
Ensembl: ENSRNOG00000019073
UniProt: Q9QY78 G3V8H5
Position
16
AA seq 757 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQVTGEQIAIKQCRQELSPKNRDRWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRRYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPFPNNLNSVLAERLEKWLQLMLTWQPRQRGVDPQYGPNGCF
RALDDILNLKLVHILNMVTGTIHTYPVMEDESLQSLKTRIREDTGILETDQELLQEAGLV
LLPDKPATQCISDSKTNEGLTLDMDLVFLFDNSKMSYETQITPRPQPESVSCVLQEPKRN
LSFFQMRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNAMASTAQQLK
AKLDFFKTSIQIDLEKYREQTEFGITSDKLLLAWREMEQAVEQCGRENDVKVLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQDMVRLLLQAIQS
FEKKVRVIYSQLSKTVVCKQKALELLPKVEEVVRLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNVSRLSHPGHLMSQPSSACDSLPDSDKKSEELVAEAHALCSRLE
SALQDTVKQQDRSFTTLDWSWLQMEDEERCGLEQACD
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttctctcccaacccagacatgtggggcctgggaaatgaaagaacgc
ctcggaactgggggatttggaaacgtcatccggtggcacaatcaggtgacaggtgaacaa
attgccatcaagcaatgccgacaggagctcagccccaagaaccgcgatcgctggtgccta
gagatccagatcatgagaaggctgaaccatcccaacgtggtggccgcccgggatgtccca
gaggggatgcagaacttggcacccaatgatttgcctctgctggccatggagtactgccaa
ggaggagacctccggagatacttgaaccagttcgaaaactgctgtggcctccgggaagga
gccatcctcaccctgctgagtgacatagcatcggctcttagataccttcatgaaaacaga
atcatccaccgggacctgaagccagagaacattgtcctacagcaaggagagaaaagatta
atacacaaaattattgatctaggatatgccaaggagctggatcagggcagtctgtgcacg
tcatttgtggggaccctgcaatacctggccccagagcttctggagcagcagaagtacacc
gtgactgttgactactggagcttcggcaccctggcctttgaatgcatcaccggcttccgg
ccctttctccctaactggcagcctgtgcagtggcactctaaagtccggcagaagagcgaa
gtggacattgttgttagcgaggacttgaacggaacagtgaagttctcaagttccttaccc
ttccccaataatctcaacagtgtcctggctgagcgtctggagaagtggcttcagctgatg
ctcacgtggcaacctcggcaaaggggcgtggacccccagtacggtcccaatggctgtttc
agggccctcgatgacatcttgaacttaaagctggttcatatcttgaacatggtcacaggc
accattcacacataccctgtgatggaggatgaaagtctgcagagcttaaaaaccagaatc
cgggaagacacagggatcctggagacagaccaggaactgctgcaggaggcagggctggtg
ctgctccctgacaagcctgctactcagtgcatctcagacagcaagacaaatgagggcctc
acactggacatggatctcgtctttctctttgacaacagtaaaatgtcctatgagactcag
atcaccccccgaccccaacctgagagcgtcagctgtgtccttcaggagcccaagcggaac
ctctccttcttccagatgaggaaagtgtggggccaagtctggcacagcatccaaacgctg
aaggaagactgtaaccggctgcagcagggacagcgagctgccatgatgaacctccttcgg
aataacagctgcctctccaagatgaagaatgccatggcctccacggcgcagcagctcaag
gccaagttggacttcttcaaaaccagcatccagattgacctggagaagtacagggagcag
acggagtttggcatcacatcggacaaactgctgctggcctggcgggaaatggagcaggcc
gtggagcagtgtgggcgggagaatgacgtgaaggtcctggtagaacggatgatggcactg
cagaccgacattgtggacctacagaggagcccgatgggtcggaagcaggggggcaccttg
gatgacctagaggaacaagcaagagaactctacagaagactcagggagaagccaagagac
caaaggacagaaggtgacagccaggatatggtacggctgctgctgcaagccatccagagc
ttcgagaagaaagtgcgggtgatttactctcagctcagtaagaccgtggtttgtaagcag
aaggccctggagctgctgcccaaagtagaagaggtggtgaggctcatgaacgaggatgag
aagactgtggtccggctccaggagaagcggcagaaggagctctggaacctcctgaagatc
gcctgtagcaaagtccgaggtccggtgagtggaagcccagatagcatgaatgtgtctcga
cttagtcaccctggtcatctaatgtcccagccttccagtgcctgtgacagcttacctgat
tcagacaagaaaagtgaagaactggtggccgaagcacacgccctctgctcccggctggaa
agcgcgctgcaggacacggtgaagcagcaggaccgaagcttcacgaccctagactggagc
tggttacagatggaggatgaagaaaggtgtggcctggagcaggcctgtgactga

DBGET integrated database retrieval system