KEGG   Rattus norvegicus (rat): 309312
Entry
309312            CDS       T01003                                 

Gene name
Gldc
Definition
(RefSeq) glycine decarboxylase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    309312 (Gldc)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    309312 (Gldc)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     309312 (Gldc)
SSDB
Motif
Pfam: GDC-P Beta_elim_lyase Aminotran_5
Other DBs
NCBI-GeneID: 309312
NCBI-ProteinID: NP_001101053
RGD: 1308660
Ensembl: ENSRNOG00000011599
UniProt: D4A5Q9
Position
1q52
AA seq 884 aa
MQLCARAWGLRLGPGAGGGHRLARGTGLSWAPRSRDSSSGGGGGGGDRGAAGASRLLERL
LPRHDDFARRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKLEDPVCENEI
LETLHAIASKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESL
LNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRYRGVIVELKLPHEMDFSGKDVSGV
LFQYPDTEGKVEDFTELVERAHQTGSLTCCATDLLALCILRPPGEFGVDIALGNSQRFGV
PLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNIC
TAQALLANMAAMFAIYHGSHGLQHIAKRVHNATLILSEGLKRAGHQLQHDLFFDTLKVQC
GCSLKEVLGRAAQRQINFRLFDDGTLGISLDETVTEKDLDDLLWIFGCESSTELVAEGMG
EEWRGLLGSSFKRTSPFLTHQVFNSYHSETNLVRYMKKLENKDISLVHSMIPLPITWREF
ANIHPFVPLDQAQGYQQLFQELEKDLCELTGYDRVSFQPNSGAQGEYAGLATIRAYLDQK
GERHRTVCLIPKSAHGTNPASAYMAGMKIQPVEVDRYGNIDVAHLKAMVDKHKENLAAIM
ITYPSTNGVFEENISDVCALIHQHGGQVYLDGANMNAQMMGGKGLKEATEIAILNANYMA
KRLERYYRVLFRGYVAHEFILDTRPFKKSANIEAVDVAKRLQDYGTLMIEPTESEDKAEL
DRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSRWDRPYSREVAAFPLPFV
KPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgcagctgtgtgccagggcatgggggctgcgcttgggccctggagccgggggcggccac
cgcctggctcggggcaccggcttgagttgggcgccgcggagccgggacagcagcagcggc
ggtggcggcggtggcggggaccgcggcgcggctggggcctcgcgcctcctggagcgcctc
ctgcccagacacgatgacttcgctcggagacacatcggcccgggagacaaagaccggagg
gagatgctgcaggcgctggggctggcgagcattgatgaactcatcgagaaaaccgtcccc
gccagcatccgcttgaagagacccttgaaactggaagaccctgtatgtgagaatgagatc
ctggaaactctgcatgccattgcaagcaaaaaccagatctggagatcctatattggcatg
ggctactataactgctcggtgccccagaccattctgcggaacttactggagaattctgga
tgggtcactcagtacactccgtatcagcccgaggtgtctcaggggaggttggagagttta
ctcaactaccagaccatggtgtctgacatcacaggcttggacatggccaatgcctcccta
ctggatgaggcgacggcggccgcagaggcaatgcaactgtgtcacagatataggggggtg
attgtcgagctgaagttaccccacgaaatggatttcagtggcaaagatgtcagtggggtg
ctgttccagtacccagacactgaggggaaggtggaggacttcacggaacttgtagaaaga
gcccatcagactgggagcctgacctgctgtgctactgaccttttagctctgtgtattttg
aggccacctggagagtttggagtggacattgccctgggcaactcccagagatttggagta
ccacttggctatgggggaccacacgcagccttttttgctgtcagagaaagtctggtgagg
atgatgcctggaaggatggtgggggtgacaagggatgccacggggaaagaagtgtatcgc
cttgctcttcagaccagagaacaacacatccggagagacaaagccaccagcaacatctgc
accgctcaggccctgttagccaacatggccgccatgtttgccatttaccatggatcccat
gggcttcagcacattgccaaaagagttcataatgctactttgattttgtctgaaggtctc
aagcgagcgggacaccaactccagcacgacctgttctttgacactttgaaggttcagtgt
ggctgctcactgaaggaggtgttgggcagagcagctcagaggcaaatcaactttcgactc
ttcgatgacggcacacttggcatttctttggatgaaacagtcactgagaaagatctggat
gatttactgtggatctttggctgtgagtcatccaccgaattggttgctgaaggcatggga
gaggaatggaggggtcttctagggtcttcattcaagagaaccagcccgttcctcactcat
caggtgttcaacagctaccactcagaaaccaatcttgttcgatatatgaagaaactggag
aacaaggacatctccctcgttcacagcatgattccactgcccatcacctggagagaattt
gccaacatccacccctttgtgccactggaccaggcccagggataccagcagcttttccaa
gagcttgagaaggatctgtgtgagctcacggggtatgaccgagtctcattccagccaaac
agtggagcgcagggggagtatgctggcctggccaccatccgagcgtacttagaccagaaa
ggagagaggcacagaacggtttgtctcattcctaagtcagcacatggaacgaatccagca
agtgcctacatggccggcatgaagatccagcctgtggaggtggacagatacgggaacatc
gatgtcgctcacctcaaggccatggtggataagcacaaggagaacctggccgccatcatg
atcacgtatccatctaccaatggtgtgtttgaagagaacatcagtgatgtgtgcgccctg
attcaccaacatggaggacaggtctacctcgacggggcaaacatgaatgcccagatgatg
gggggaaagggtctcaaagaggccacagaaatcgccattctaaatgccaactacatggcc
aaacgattagagagatactacagagtcctcttcagagggtacgtggctcatgaattcatt
ttggacacacgacccttcaaaaaatctgccaacatcgaggctgtggatgttgccaagagg
ctccaggattacgggaccctcatgattgagcccaccgagtcggaagacaaggccgagttg
gacagattctgtgatgctatgatcagcatccggcaggaaatcgcggacatagaggagggc
cgcatcgacccacgggtcaaccccctgaagatgtctccacactccttgacctgtgtcaca
tcctcccgctgggatcgcccatattccagagaggtggcagcatttcctctgccctttgtg
aaaccagagaacaaattctggccaaccattgctcggatcgacgacatctacggagatcag
cacctcgtctgcacctgcccacccatggaggtctacgagtctccgttttctgaacagaaa
agggcctcttcttag

DBGET integrated database retrieval system