KEGG   Rattus norvegicus (rat): 309362
Entry
309362            CDS       T01003                                 

Gene name
Dnmbp
Definition
(RefSeq) dynamin binding protein
  KO
K20705  dynamin-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309362 (Dnmbp)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    309362 (Dnmbp)
SSDB
Motif
Pfam: SH3_9 SH3_1 BAR SH3_2 RhoGEF SH3_3
Other DBs
NCBI-GeneID: 309362
NCBI-ProteinID: XP_006223824
RGD: 1583840
Ensembl: ENSRNOG00000050742
UniProt: M0R4F8
Position
1q54
AA seq 1577 aa
MEPGSVVRAIFDFCPSVSEELPLFVGDVIEVLTVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCTCDFISREPNSLSLHRGDLVIIDGTPTAGWLQGRSSLGARGFFPSSC
IHELCLSSQSRQWHSQNMLLQVPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTADESVNAGSGDDSTLNDEVDVSPEEVESEGDED
DQQAGTYGIALYRFQALESNELDFEVGDKIRILGTLEDGWLEGRLKGKTGIFPHRFVKLC
PSNRSEETMALPQGDSFPKNSESSAGEMGDSVVEEARQDPQECEEETPDSGLPEQTSEEP
LDHVAPECVVDKISGQDEDASGSSPDVDLEGPRAEDPSTPDLSQEVNGISSLPPQVPLQP
EEEKSQHYLTAGGSRQCPDTFSKLFPLEAKTRNYSSLPPRRTYTQGWSLQKPAPHLHRAS
SLTASRVNRPGHFSHTAMASCAQKHQTSAENAASLCCAPERPKRRPGLPDKEPATEITPA
SQGDNLDLDSKLTQQLIEFEKSLSGPSTEPKKIVRRFSIMDFYSEKDIVRGSSNSLPSRN
FPERRKALRPPPPRPHTPTSTSPHLLVDQSPKPGPPLVVRPSRPAPLPPPTQQRLNTASP
KPTSCALPGWEAPEKEGSEYTEKSPAQLFPCPSVLARIQDVEHDLDMHTRAQEELNLLLE
EKQDESLRAETLETLKSYESTIQSLNLELQQLREMTLLSSQSSSLAAPSGSVSTEKPEQR
MLEKRAKVVAELLQTEKDYIRDLEMCVERVMVPLQQAQVPNIDFEGLFGNMQTVIKVSKQ
LLAALEITDAVGPVFLDHRDELEGTYRLYCQNHDEAISLLDIYEKDERIQKHLQDYLADL
KSLYHEWGCTNYINLGSFLIKPVQRIMRYPLLLMELLNSTPESHPDKAPLTSAVLAIKEI
NANINEYKRRKDLVLKYRKADEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQLKD
EAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAMSIWDLCMERGHHDLEQF
EKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTERAEK
LKDKKTLEDLQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQKALEQ
LQPLLSLLKASDREGNLIAIFHEEHSRVLQQLQVFTFFPEALPAPRKPFERKTTDRQSSR
KALLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKKKDP
MGSQNRWLVDNGVTKGFVYSSFLKPYNPRCSHSDSSVVSHSSTESEHSGSSPSFHRQNSS
SALTFNSNSMTVSFTSGLPQKQPQDTSPLRECVPETLGVSSNTGNPETGPSPCPSDPGFS
CQRRPGNPADGTREISQPASTLRGCQRRSLHSEVLGYPVPGRSDQGSDSIKGTSRACQTA
GDRDRGLGSSEAEGNQVYFAIYTFKARNPNELTVLANQRLRILEFKDVTGNTEWWLAEVN
GKKGYVPSNYIRKTEYT
NT seq 4734 nt   +upstreamnt  +downstreamnt
atggagcctgggtccgtggtgcgtgccatctttgacttctgccctagcgtctcggaggag
ctgccactcttcgtgggggacgtaattgaggtgttgaccgtggtggatgaattttggctt
ttagggaagaaggaagatgttacaggacagttccccagcagtttcgtggagatcgtgaca
attcccagtctgaaagagggagagaggctgtttgtttgcacctgcgatttcatatctcga
gagccgaatagtctttccctccatcgaggagacctggtgattattgatggtactcccaca
gcaggatggctgcagggccgaagctccctgggcgccaggggtttctttccgtcttcgtgc
atccatgagctctgcctctcctctcaaagccgacagtggcattcccagaacatgctgctg
caggttccagagtactccatgggacaagcacgggccctcatgggcctctctgcccagttg
gatgaggagttagacttcagggaaggagacgtgatcaccattatcggggtgcctgaacca
ggctggtttgagggagagctagagggccgaaggggcattttcccagaaggttttgtagag
cttctggggcccctgaggactgcggatgagtcggtaaacgctggaagtggagatgactcc
acgctcaatgatgaagtggatgtgtctccagaagaagtggagagtgagggtgacgaggac
gaccagcaggcggggacctatgggattgccctctacagattccaagccctggaatcaaat
gagttggattttgaggtaggggacaaaattcgaattctggggaccttggaggatggctgg
ctggaagggcgtctgaagggcaagacaggcatctttccccatcgctttgtgaagttatgt
cctagcaacagatcagaggaaaccatggctctgccccagggagacagcttccccaagaac
tctgaaagctcagcgggcgagatgggggactccgtggtggaggaagcaagacaggatcca
caggagtgtgaagaagaaacacctgactctggtctcccagaacaaacctctgaggagccc
ctggatcatgtggcccccgagtgtgttgtagataagatctctggtcaggatgaagatgcc
tcaggaagctccccagatgtggatcttgaagggcctcgtgctgaagacccttccacacct
gacctctcccaggaagtcaatggcatttcttccctgcctccacaggtacctcttcaaccc
gaagaggagaagagccagcattatttaacagcaggagggagccgccaatgcccagacaca
ttctccaagcttttccctctagaagccaagaccaggaactactccagcctgcctccaaga
agaacatatacccagggctggtcgcttcagaagccagcgccccacctccacagggcctcc
tccctcacagcgtcaagagtaaacagacctggccactttagccacacagccatggccagc
tgtgctcagaagcaccaaacatctgcagaaaatgctgccagcctctgctgtgcacctgag
agaccaaagaggaggcctggcctaccagacaaggaacccgccacagaaataaccccagcg
tcacagggggacaacctggacttagattccaagttgacccaacagctgatagagtttgag
aagagtctgtcagggcccagcacagagccaaagaaaattgtacgccgcttttcaatcatg
gacttttactcagagaaggatatcgtgagaggctcctcaaactcactaccctcacggaat
ttccctgagaggagaaaggccctgaggccaccgccgcccagacctcataccccaacatcc
acttctccccatttgctggttgaccagagcccaaaacctggaccccccttggttgtgagg
ccatcccgcccggctcccctgccacctcctacccagcagaggctgaacacagcctctccc
aagcccacctcctgtgcccttcctggctgggaggctccagagaaggagggctctgagtac
acagagaagagcccagcccagctttttccgtgcccatctgtgctggcgaggattcaggat
gtggaacacgacttggacatgcacaccagggctcaggaagagctgaacttgctgttagag
gaaaagcaagatgaatcgttgagggcggagactctcgagactctcaaatcctacgagagc
accattcagagtctgaacctggagctccagcagctgagagagatgacgctcctctcctcc
cagtcttcatccctggcggccccctctgggtctgtgtccaccgaaaagcctgagcagagg
atgctggagaagagagccaaggtggtggctgagcttttgcagacggaaaaagactacatc
cgggatctggagatgtgcgtcgagagggtcatggtgcccctgcagcaggcacaggtacca
aacattgattttgaaggactttttggaaacatgcaaacggtgattaaagtctcaaagcag
ttgttggcagccttggaaatcaccgatgctgtaggacccgtgtttctggatcaccgggac
gaacttgaggggacgtacagactttactgccagaaccacgacgaagccatttcactgcta
gatatctacgagaaggacgagaggatccagaagcatctccaggactacttggcagatctc
aagagcctgtaccacgaatggggatgcaccaattacatcaacctgggctctttcctcatc
aagcccgtacagagaataatgcgttacccgctgctgctaatggagctgctgaattccacc
ccggaatcccacccggataaagcgcctttaaccagcgcagtcctggccatcaaggaaatc
aatgctaacattaatgaatataagcgtcggaaggatctagtgcttaagtaccgcaaagcg
gatgaagacagcctcatggagaagatctccaagctcaacatccactccatcatcaagaag
tccagccgggttagcagtcacctgaaacacctcactggcttcgctccccagctaaaagat
gaagcatttgaagagacagaaaagaacttccggatgcaggagagattgattaaatctttt
atccgagacctgtccctctacctccagcacatacgggaatctgcttgtgtgaaggtggtg
gcagccatgagcatatgggatctgtgcatggagaggggacatcatgacctggaacagttt
gagaaggtgcatcgatacatcagcgaccagctcttcacacggtttaaagagaggaccgag
cggcttgtcatcaatcccttaaaccagctgttgaacatgttcacggggccctacaagctg
gtgcagaagcgtttcgacaagctcctggacttctacaactgcactgagcgagcggagaag
cttaaggacaagaagactctggaggatctccagtcagcccgaaacaactacgaggccctg
aactcccagctgctggacgagctgcccaagttccagcagtacgcccagagcctcttcacc
aactgcatccacggctacgccgaagcccactgtgacttcgtgcagaaggcgctggagcag
ctgcagcccctgctgtcgctactgaaagccagcgaccgagaaggcaacctgatcgccatc
ttccacgaggagcacagccgggtccttcagcagctccaggtcttcactttcttccccgag
gccctcccagcccccaggaagcccttcgagaggaaaaccacagaccgccagtcatcacgg
aaggccctcctgggcatgccaagctacatgctgcagtcagaagaactgcggagctccctg
ctggcgaggtacccaccggaaaagctcttccatgtccaacgcaacttcaacgcagctcag
gacttggatgtctcccttttggaaggtgatctggtgggcgtgatcaaaaagaaagacccc
atgggcagccagaaccgctggctcgtggacaacggagtcaccaaaggctttgtctacagc
tccttcctgaagccttacaaccctcgatgcagccattcggattcctctgtggtcagccac
tcttccacagagtccgagcacagcggctcctcccccagcttccatcgccagaacagcagc
agtgccttgaccttcaactccaacagcatgactgtgtccttcacctcagggcttccccag
aagcagcctcaggacacatctccactgagggaatgtgtccccgaaactcttggtgtgtcc
tcgaacacggggaacccagaaactggaccttccccatgcccttcagatccaggcttctcc
tgccagcgcaggccgggcaaccctgcagatggcacccgagagatcagccaacctgcttca
accttgaggggctgccagcgacgctccctgcattccgaagtgctcggttaccctgtgcca
gggcgcagtgaccaaggcagtgactccataaaaggaacctcaagagcctgtcagaccgca
ggagacagagacagagggctcggaagcagcgaggcagagggcaaccaggtctattttgcc
atctacaccttcaaggcacgaaacccaaatgagctgactgtgttggccaatcagagactc
aggatccttgagtttaaagacgtcacaggcaatacagagtggtggttggctgaagttaac
ggaaagaagggctacgtcccgtccaactatatccgaaaaactgagtacacctga

DBGET integrated database retrieval system