KEGG   Rattus norvegicus (rat): 309375Help
Entry
309375            CDS       T01003                                 

Gene name
Marveld1, Mrvldc1
Definition
(RefSeq) MARVEL domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 309375
NCBI-ProteinID: NP_001101060
RGD: 1309811
Ensembl: ENSRNOG00000042620
UniProt: D3ZR15
Position
1q54
AA seq 91 aa AA seqDB search
MITLMWPRALGNWQYSPWLTSLTTRTGAKPRPPRQLPTINLGLLVGPGDNFYIVYEGHAG
VGFGVGRVVRERGHVPYPVVYSRLPQYAFSE
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccctgatgtggcccagagcacttggaaactggcagtactctccctggcttacc
tctctgacaaccaggactggggccaagccaagaccacccagacagctcccaaccataaat
ctggggcttcttgtgggcccgggagacaatttctacattgtgtacgaaggccacgcaggg
gtgggttttggtgtagggagggtggttagagagaggggccatgtgccttatccagtagtg
tattcaaggttaccccagtatgctttttcggaataa

DBGET integrated database retrieval system