KEGG   Rattus norvegicus (rat): 309390
Entry
309390            CDS       T01003                                 

Gene name
Entpd7
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 7
  KO
K14643  ectonucleoside triphosphate diphosphohydrolase 7 [EC:3.6.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    309390 (Entpd7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     309390 (Entpd7)
SSDB
Motif
Pfam: GDA1_CD39
Other DBs
NCBI-GeneID: 309390
NCBI-ProteinID: NP_001101065
RGD: 1310638
Ensembl: ENSRNOG00000016883
UniProt: D3ZNB5
Position
1q54
AA seq 341 aa
MEVQLGMPVLVKEDHCWGEEAAKILLAEFNLGCDVQHTEHVYRVYVTTFLGFGGNFARQR
YEDLVLNETLNKNRLLGQRTGLSPDNPFLDPCLPVGLTDVVERNSQVLHFRGKGDWATCR
TMLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSEFFYCTEDVLRIGGRYHGPTFAKA
AQDYCGMTWSVLAQRFKNGLFSSHADEHRLKYQCFKSAWMYEVLHEGFHFPYDYPNLQTA
QLVYDREVQWTLGAILYKTRFLPLRDLRQGGVRQAHGSWFRLSFVYNHYLFFACTLVVLL
AIVLYLLRIHRIHRRQTRASAPLDLLWIEQVVPMIGVQVGP
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaagttcagttgggaatgccagtactggtgaaggaagatcactgttggggggaagaa
gctgccaagatcctgctggctgagttcaacctgggctgtgatgtgcagcacacggagcat
gtgtacagggtttatgtcactacctttctgggttttgggggcaactttgcccggcagcgc
tatgaagatctggtgctgaatgaaacgcttaacaaaaacagattgctgggccagaggaca
ggcctgagtcctgacaatccctttctggacccctgcctgcccgtgggactcacggatgtg
gtggagaggaacagccaggtccttcacttccgagggaagggagactgggccacttgtcgg
acgatgctaagccccctgctagcccgctccaacaccagccaggcctcactgaacggcatt
taccagtcaccaatcgacttcaacaacagcgagttctatggcttctcggagtttttctac
tgcacagaggatgtactgcgcatcggaggccgctaccatggaccgacatttgccaaggct
gctcaggattactgtggcatgacttggtcggtgctagcccagagattcaagaatggcctc
ttttcttcacatgcagatgagcatcgactcaagtatcagtgttttaagtcagcttggatg
tatgaagtccttcacgaggggttccacttcccctacgactacccaaacctgcagacagcg
cagctggtgtacgaccgagaggtgcagtggacgctgggcgcaattctgtataaaacccga
ttcctgccactcagggacctccggcagggaggagtccggcaagcccacggcagctggttc
cgcctttcttttgtctacaaccactatctcttctttgcttgtacgctggtggtgcttctg
gccatcgtcttgtaccttctgcgcatccacagaattcaccgcagacaaacccgagcctcg
gctccactggacctgctgtggatcgagcaagtggtgccgatgattggggtgcaggtgggg
ccgtga

DBGET integrated database retrieval system