KEGG   Rattus norvegicus (rat): 309419
Entry
309419            CDS       T01003                                 

Gene name
Pip5k1b
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04510  Focal adhesion
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05231  Choline metabolism in cancer
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    309419 (Pip5k1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    309419 (Pip5k1b)
   04072 Phospholipase D signaling pathway
    309419 (Pip5k1b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    309419 (Pip5k1b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    309419 (Pip5k1b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    309419 (Pip5k1b)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    309419 (Pip5k1b)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    309419 (Pip5k1b)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    309419 (Pip5k1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309419 (Pip5k1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     309419 (Pip5k1b)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    309419 (Pip5k1b)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    309419 (Pip5k1b)
 Endosome - Golgi transport
  Others
   Others
    309419 (Pip5k1b)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 309419
NCBI-ProteinID: NP_001012761
RGD: 1310914
Ensembl: ENSRNOG00000015232
Vega: OTTRNOG00000000898
UniProt: Q5CZZ9
Position
1
AA seq 539 aa
MSSTAENGDAVPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRAMRMHLTYDLKGSTYKRRASRKEREKPNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHILDHSLKDKEEEPLQNAPDAKRPGMQ
KVLYSTAMESIQGPGKSADGIIAENPDTMGGIPAKSHKGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEILSSISQEWKDEKQDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVGEHYPHDRTTLYSNSKGLPSSSTFTLEEGTIYLTAEPNALETQDDASVLDVYL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgtcgtcaactgctgaaaatggagacgccgtacctggaaaacaaaacgaagaaaaaacc
tacaaaaagactgcatcatcagctattaaaggtgccattcagctgggaataggatacaca
gtgggtaatctcacttccaagccagaacgcgatgtcctcatgcaagacttttatgtggtg
gaaagtgtattcctccccagtgaagggagcaatctgaccccagcacatcactacccagac
ttcaggtttaagacatacgccccgctggctttccgctacttccgagaactctttggtatc
aagcccgacgattacttgtactccatctgcagtgaaccgctgatagaactgtccaatcct
ggagccagtggatccttgtttttcttgaccagcgatgatgaatttattatcaaaactgtt
cagcataaggaagccgagttcctgcagaagctgctgccaggctattacatgaatctaaac
cagaatccaaggactctcctgccgaaattctatggtctgtattgcatgcagtcaggaggc
atcaacatccgcatcgtggtgatgaacaacgtgctgccgcgtgccatgaggatgcacttg
acctatgacctgaaaggctccacgtacaaacgaagggcgtcccgaaaagagagggagaaa
cccaaccccacgtttaaggacctggacttcctgcaggacatgcatgaggggctgtatttc
gatacagaaacatacaatgcccttatgaagacactacagagagactgccgggtgctggaa
agcttcaagatcatggactacagccttttgctgggtatccacatcttggaccattccctc
aaagacaaagaagaggagcccctccaaaatgcacccgacgcaaagcggccggggatgcag
aaagtcctctactccacagccatggagtccatccagggtccaggcaagtccgcagatggg
atcattgcagagaacccagacacaatgggaggcattccagctaaaagccataagggagaa
aagctgcttctattcatgggcattattgatattctccaatcatataggttaatgaagaag
ttagaacactcctggaaagctcttgtgtatgatggggacaccgtttcagttcatagacca
agtttttatgcagatagatttttaaagtttatgaattccagagttttcaagaaaattcaa
gctctgaaggcctcaccttctaagaaacggtgcaactccatcgctgcactgaaggcaacc
tcccaggagattctgtcctccatcagccaagaatggaaggatgagaagcaggatctgtta
accgaagggcagagtttcagcagcctggatgaagaagccctgggatcccgacacaggcct
gacctggtgcccagcacgccgtcattatttgaagctgcttccttagcaaccacaatatca
tcttcttccttatatgtcggtgagcactatccacacgacaggactacgctttactcaaac
agcaaagggttaccttccagttcaaccttcaccttggaagaggggaccatctacctgact
gctgagccaaacgccctggaaacgcaggatgacgcctccgtgctggatgtctatttataa

KEGG   Rattus norvegicus (rat): 314641
Entry
314641            CDS       T01003                                 

Gene name
Pip5k1c
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 gamma isoform c
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04510  Focal adhesion
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05231  Choline metabolism in cancer
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    314641 (Pip5k1c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    314641 (Pip5k1c)
   04072 Phospholipase D signaling pathway
    314641 (Pip5k1c)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    314641 (Pip5k1c)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    314641 (Pip5k1c)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    314641 (Pip5k1c)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    314641 (Pip5k1c)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    314641 (Pip5k1c)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    314641 (Pip5k1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314641 (Pip5k1c)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     314641 (Pip5k1c)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    314641 (Pip5k1c)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    314641 (Pip5k1c)
 Endosome - Golgi transport
  Others
   Others
    314641 (Pip5k1c)
SSDB
Motif
Pfam: PIP5K Toxin_33
Other DBs
NCBI-GeneID: 314641
NCBI-ProteinID: NP_001009967
RGD: 1309938
Ensembl: ENSRNOG00000020577
UniProt: Q5I6B8 Q3MID5
Position
7
AA seq 688 aa
MELEVPDEAESAEAGAVTAEAAWSAESGAAAGMTQKKAILAEAPLVTGQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
VLPRVVKMHLKFDLKGSTYKRRASKKEKEKSLPTYKDLDFMQDMPEGLLLDSDTFGALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQQERERQAEGAQSKADEKRPVAQKALYSTAMES
IQGGAARGEAIETDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSSTVFRKSSSLKSSPSKKGRGALLAVKPLGPTAAFSASQIP
SEREDVQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPS
DTSEQPRYRRRTQSSGQDGRPQEELHAEDLQKITVQVEPVCGVGVVVPKEQGAGVEVPPS
GASAAATVEVDAASQASEPASQASDEEDAPSTDIYFFAHGRYWLFSPRRRRLRAVTPSHT
GAPTDERSWVYSPLHYSARPASDGESDT
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggagctagaggtgccggacgaggcagagagcgccgaagcaggggccgtgacagcggag
gcggcctggtctgcggagagtggggcggcggcaggtatgacccagaagaaggctatcctt
gcagaggccccgttggtgacagggcagccaggccctggccatgggaagaagctgggccat
cgaggcgtggatgcgtctggagagactacgtataagaagaccacctcgtccaccctgaag
ggtgccatccaactggggattgggtacacggtgggcaacctcagctctaagccagaacgc
gatgtgctcatgcaggacttctatgtggtggagagcatcttctttcccagcgaagggagc
aaccttacccccgcccaccacttccaggatttccgtttcaagacctatgcacctgttgcc
ttccgttacttccgggagctctttggtatccgtccggacgattacttgtactcactctgc
aacgagccactcattgagctgtccaacccgggtgccagtggctccgtcttctacgtcacc
agcgatgacgagttcatcattaagactgtcatgcacaaggaggcggagttcctgcagaaa
ctgctgcctggctactatatgaacctcaaccagaacccccggaccttgctgcccaagttc
tatgggctgtactgtgtgcagtccggcggcaagaacattcgagtggtggtcatgaacaat
gtgctgccccgtgtcgtcaagatgcacctcaagttcgacctcaagggctccacgtacaag
cgcagggccagcaagaaggagaaggagaagagcctgcccacctacaaggacctggacttc
atgcaggacatgccagaggggctgctactggactctgacacctttggcgccctggtcaag
acgctgcagcgagactgcctggtgttggagagcttcaagataatggactacagcctgctg
ctgggtgtgcacaacattgaccagcaggagcgggagcgccaggccgagggcgcccagagc
aaggctgacgagaagcggccggtggcccagaaggccctctactccacagccatggagtcc
attcagggcggagctgcccgtggggaggccattgagacagatgacacgatgggtgggatc
ccagccgtgaatgggcgtggggagcgcttgctcctacacatcggaatcattgacattctg
cagtcctacaggttcatcaagaagttagaacacacctggaaggccctcgtccacgatggg
gataccgtctcagtccaccggcccagcttctatgccgagcgcttcttcaagttcatgagc
agcacggtcttccggaagagttcctccctcaagtcctctccatctaagaaagggcgtggc
gccctgctcgcagtcaagcccctggggcccaccgcagccttctcagctagccagatcccc
agtgagagagaggatgtgcagtacgacctgcggggggcccgcagctaccccacgctggag
gatgaaggccggcctgacctcctgccctgcaccccaccgtcctttgaggaagccaccaca
gcctctatcgccaccaccctgtcatccacctccctctccatcccagagcggtccccttca
gacacatcagagcagccccggtacaggcggcgtacgcagtcttcaggccaggatggccgg
ccccaggaggagctgcatgcggaagacctgcagaagataactgtgcaggtggagccagtg
tgtggtgtgggggttgtcgtccccaaggagcagggtgcaggagtggaggttcccccatct
ggggcatcggcagcagccacggtggaagtagacgctgccagccaggcctcagagcccgcc
agccaagcctctgatgaggaagatgcgccttccacagacatctattttttcgcccacggg
agatactggcttttctctccccgtcgtcgccgactgcgggccgtgacaccaagccacaca
ggcgctcccaccgacgagaggagctgggtgtactccccgcttcactatagcgcacggccc
gcctccgacggcgagagcgacacataa

KEGG   Rattus norvegicus (rat): 365865
Entry
365865            CDS       T01003                                 

Gene name
Pip5k1a
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04510  Focal adhesion
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05231  Choline metabolism in cancer
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    365865 (Pip5k1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    365865 (Pip5k1a)
   04072 Phospholipase D signaling pathway
    365865 (Pip5k1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    365865 (Pip5k1a)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    365865 (Pip5k1a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    365865 (Pip5k1a)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    365865 (Pip5k1a)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    365865 (Pip5k1a)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    365865 (Pip5k1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    365865 (Pip5k1a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     365865 (Pip5k1a)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    365865 (Pip5k1a)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    365865 (Pip5k1a)
 Endosome - Golgi transport
  Others
   Others
    365865 (Pip5k1a)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 365865
NCBI-ProteinID: NP_001036086
RGD: 1306127
Ensembl: ENSRNOG00000021068
Position
2
AA seq 546 aa
MASASSGPAAAGFSPLDSGVPAGTAASGIKRGTVSEGPYASLMPVKKIGHRSVDSSGETT
YKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYND
FRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTV
QHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHM
KYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVLQ
SFKIMDYSLLMSIHNMDHAQREPMNSETQYSIDTRRPAPQKALYSTAMESIQGEARRGGT
VETEDHMGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGF
YAERFQRFMCNTVFKKIPLKPSPTKKFRSGPSFSRRSGPSGNSCTPSQPTASGEHKAQVT
TKAEVEPDIHLGRPDVLPQTPPLEEISEGSPVPGPSFSPAVGQPLQILNLSSTLEKLDVA
ESELTH
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggcgtccgcctcctcagggccagcggcggcggggttttcaccccttgattccggggtc
cctgccggtaccgcagcatctggaatcaagagaggcacagtatctgagggaccttatgcc
tctctcatgcctgtcaagaaaataggccatcgaagtgttgattcctctggagagactaca
tacaaaaagacaacttcatcagccttgaaaggtgccatccagttaggtatcactcacact
gtgggcagccttagcaccaaaccagagcgggacgtcctcatgcaagacttctacgtggtg
gagagcatcttcttccccagtgaaggcagcaacctgacaccggctcaccattacaatgac
tttcggttcaagacctatgcacctgtcgccttccgttacttcagagagctatttggcatc
cggcctgacgattacttgtactccctttgcagtgagccattgattgaactctccaattct
ggagctagcggttccctcttctacgtgtccagtgatgatgaattcatcattaagaccgtc
cagcataaagaggcagaatttctgcaaaaattgcttccaggatactacatgaatcttaac
caaaaccctcgtactttgctgcccaaattttatggactgtactgtgtgcaagcaggcggc
aagaacatacgaattgtggtgatgaacaatctcttgcctcggtcagtcaaaatgcatatg
aaatatgatctcaagggttcaacttacaagcggcgggcttctcagaaagaacgagagaag
actctccccacctttaaagacctggacttcctacaagatatccccgatggccttttttta
gatgctgacatgtacagtgctctatgtaagactctgcagcgtgactgtctggtgctgcag
agcttcaagattatggactatagcctgttgatgtccatccacaacatggatcatgcccag
cgagagcccatgaacagcgaaacacaatactcaattgacactcgcagaccagccccgcag
aaggctctctattccacagctatggagtccatccagggcgaggctcgccggggcggcact
gtggagactgaggaccacatgggtggcatccctgccagaaacaacaaaggggaaaggctc
ctgctttacattggcatcattgatattctgcagtcctacaggtttgttaagaagttggag
cactcttggaaagccctggtccatgatggggacacggtgtcagtacatcgtccaggcttc
tatgctgaacggttccagcgcttcatgtgcaacacagtgttcaagaagattcccttgaag
ccttctcctaccaaaaagtttcggtctggcccatctttctctcggcgatcaggccccagc
ggcaactcctgcactccttcccagccgacagcctctggggaacacaaagcacaagtgact
acgaaggcggaagtggagccagatatacaccttgggcgtcctgatgtcttacctcagact
ccaccgttggaggagataagtgagggttcacctgttcctggtcccagtttctcacctgca
gttggacaacctttgcaaatactaaatttgagttcaaccttggaaaagcttgatgttgca
gagtcagaactcacccattga

DBGET integrated database retrieval system