KEGG   Rattus norvegicus (rat): 309433
Entry
309433            CDS       T01003                                 

Gene name
Sec31b
Definition
(RefSeq) protein transport protein Sec31B
  KO
K14005  protein transport protein SEC31
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    309433 (Sec31b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309433 (Sec31b)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    309433 (Sec31b)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    309433 (Sec31b)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   309433 (Sec31b)
SSDB
Motif
Pfam: WD40 Sec16_C
Other DBs
NCBI-GeneID: 309433
NCBI-ProteinID: NP_001129185
RGD: 1598329
Ensembl: ENSRNOG00000025781
Position
1
AA seq 1179 aa
MKLKELEKPAVQAWSPAKQYPVYLATGTSAQQLDASFSTNATLEIFEVDFRDPSLDLKRK
GILSVSSRFHKLIWGSSSSGLLENTGVIAGGGDSGMLTLYNVTHILSPGKEPLIAQKQKH
TGAVRALDFNPFQGNLLASGASDSEIFIWDLNHLTVPMTPGSKSQNPPEDIKALSWNRQV
QHILSSAHPSGKAVVWDLRKNEPIIKVSDHSSRMNCSGLAWNPDIATQLVLCSEDDRLPV
IQLWDLRFASSPLKVLESHSRGILSVSWSQADAELLLSSAKDNQIFCWNLSSSEVVYKLP
TQSSWCFDVQWCPRNPPAFSAVSFDGWISLYSVMGRSWEAQQHMRQADKISSSFSQGQPL
PPLQVPEQVAQASLIPPLKKPPKWMRRPAGVSFAFGGKLVTFGLPSIPVQQVPQPCPRPV
FISQVITESEFLTRSVVLQEALGSGNLLNYCQSKIQQASRPSEKTLWQFLKVTLEHDSRL
KFLRLLGYSRDELQKKVDTCLKSDSKSQESPQLEAVDLKSDRAHTLCSQASRHTAKEASA
SSAFFDELIPQNMTPWEIPTTEDTDGLLSQALLLGELRSAVELCLKEERFADAIILAQAG
DAELLKWTQERYLAKRRTKTSSLLACVVKKNWKDLVCACSLKNWREALALLLTYSGPEKF
PELCDMLGARMEHEGGRELTSEARLCYVCSGSVERLVESWADSQQASSPVALQELMEQVT
VLSRSLELLQGSHKMSPGPATTHRFTQYASLLAAQGSLAIAMSVLPSDCTQPAVLQLKDR
LFHAQGSTVLGRQAPAFPFPRVAVGAALHPKETSSHRMGFQPPRQVPAPSVRPRAAAQPS
VMPFLPSHPIPSVGSWTQSSSDYRVPKPQATLPVHFVPGVRPAFSQPQPFGGQSVQAINP
VGFCGTWPLPGPTPVMAPPDVMQPGSTHLPETPRLLPLPPVGPPGPTPLSSQPAASPVTF
SVAHPPGGPGAPRSSALPSSGILATRPGPQDTWKVAPASQENLQRKKLPETFMPPAPIIT
APLMSLGPEPQQALLPQSLVSGASLPPPGAPRECSLQQLQPLPPEKTQKELPPEHQCLKD
SFEALLQRCSLTATDLKTKRKLDEAAHRLECLYEKLCEGTLSPHVLAGLHEVARCVDAGS
FEQGLAVHAQVVSCSSFSEVSSFMPVLKAVLTIAHKLQG
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgaagttgaaggagcttgagaagccagctgtccaagcatggagcccagcgaagcagtac
cctgtgtatctggccacaggaacatccgcccagcaactagatgcctccttcagcacaaat
gccaccctggaaatatttgaggttgatttcagggacccttctctggacttgaaacgcaaa
ggaatcctctctgtgtcaagcaggtttcacaagctaatctggggaagctccagcagtggg
cttctggagaacactggggttattgctggtggaggagacagtggcatgcttaccctatac
aatgtgacccacatcctttctccggggaaggaacccttgattgcccagaaacagaagcac
acaggagctgtcagagccttggactttaatcctttccagggcaacctcctggcctcagga
gccagtgattctgaaatcttcatttgggatttgaaccacctgactgttccaatgacacct
ggatccaagtcacagaaccccccggaagacattaaagcattgtcttggaaccgccaagtc
cagcacattctgtcttctgctcaccccagtggcaaggcagttgtgtgggatctcaggaag
aacgagcccatcatcaaagtcagcgaccacagcagcaggatgaactgctcaggcctggcc
tggaacccagacatagccacacagttagtgctgtgctcagaagatgaccggctcccagtg
attcagctgtgggacctgcgcttcgcttcctcacccctgaaggtgttggagagccacagc
aggggcatcttgtcggtgtcctggagccaggctgatgctgaactgctgcttagcagtgcc
aaagacaaccagattttttgctggaatctgtcaagcagtgaggtggtctacaagctaccc
acacagagcagctggtgctttgacgttcagtggtgccctcggaaccctcctgcgttctct
gctgtctccttcgatggctggatcagtttgtactctgtgatgggtaggagctgggaagcc
cagcagcacatgaggcaggctgacaagatttcctcttcctttagccaaggccagcctctc
ccaccactgcaggtgcctgagcaggtggcccaagcatcactaattcctcccttgaagaag
cctcccaagtggatgagaaggccggcaggcgtttcattcgcttttgggggaaagctggtt
acctttggccttcccagcatccctgtccagcaggtgccacagccttgtccccgccctgtc
ttcatcagtcaagtcatcacagagtcagaattcctgactcggtcagttgtgctgcaggag
gccttgggatctggaaatctccttaattattgtcagagcaagattcagcaagcttcacgg
ccaagtgagaagacgctctggcagtttctgaaggtgaccttggagcatgattccagactg
aagttcctcaggctgttaggttacagcagagatgaacttcagaagaaggtggacacatgc
ctgaagagtgactcgaaatcacaggagagccctcagcttgaggcagttgacctcaaaagt
gacagagcacacaccctttgcagccaggcctccagacacactgccaaggaagcctctgca
tcctcagccttctttgatgagctgatacctcagaacatgactccctgggagatccccacc
acagaagacactgatgggctcctgagccaggccctgctgctcggggaactgcggtctgct
gtggagctctgtctgaaagaggaacgctttgctgacgccatcatcctggctcaggctggg
gacgcagagctactcaagtggacacaagaacgatacctagccaagaggagaaccaaaacc
tcctcgcttctagcctgtgtcgtaaagaagaattggaaggacctagtatgtgcctgtagc
ctgaagaactggagagaggcgctggccttgctgctgacgtattcagggccagagaagttc
cctgagctctgtgacatgctgggagctcgcatggagcacgagggaggcagggagctcacc
tctgaagccaggctgtgctatgtgtgctcagggagtgtggagcggctggtagagagctgg
gcagactcccagcaagcctcgagccccgtggctctgcaggagctaatggagcaggtgacg
gtcctcagcaggagcctggagctcctccagggttctcacaagatgagcccaggtcctgcc
acaacacacaggttcacccagtatgccagtctcctggcagcccagggcagcctggccatt
gccatgagtgtcctacccagtgactgtacccagcccgcagtcctgcagctgaaagatcgg
cttttccatgcccaaggttctaccgtcttgggccgacaggctcctgctttcccgtttccc
cgcgttgctgtaggagctgctctccacccaaaagagacatcatcacacagaatgggattc
cagcctcctcgccaggtcccagctccatctgtgaggccgagggccgcagctcagccgtca
gtgatgcctttcctcccctcccatcccatcccttctgtgggctcgtggacacagtcctca
agtgactacagggtccccaaaccccaagcaaccttgcctgtgcatttcgtccctggagta
aggcctgctttctctcagccacagccattcggaggacaaagtgtccaagctataaaccct
gttggattctgtggaacatggcctcttcctggtcctactccagtcatggcacccccagat
gtcatgcagcctggctctacccacctgcctgaaactcctagactgctccctctgcctcct
gtgggaccaccaggtcccacccctctgagctcccaacctgcagcctctcctgtcactttc
tctgtggctcaccctcctggcggccctggagcaccacgctctagtgccctcccgagctct
ggcatcttggccactcgtccaggaccccaggatacctggaaagttgctccagcctcccag
gaaaacctccaaaggaaaaagttgcctgagacatttatgcctccagcaccaataattaca
gctccacttatgagccttggccctgagccacaacaggccctgctgccacagtccctagtc
tccggtgcaagcctgcctcctcctggagccccgagagaatgcagcctgcagcaactccag
ccactgccccctgagaagacacagaaagagctgcccccagagcatcagtgcctgaaggac
agctttgaggcgctccttcagcgctgttccctgaccgccactgacctaaaaacaaaaagg
aagctggatgaggcagcccaccgtctagaatgtctatacgagaagctgtgcgaggggaca
ctctcaccccatgtcctggctgggctccatgaagtcgcccgctgtgtggatgcaggaagc
tttgaacagggccttgcagtgcatgcccaggtagtgagctgcagcagcttcagcgaggta
tccagcttcatgcctgtcctgaaggctgtcctcaccatcgcgcacaagctgcagggctaa

DBGET integrated database retrieval system