KEGG   Rattus norvegicus (rat): 309441Help
Entry
309441            CDS       T01003                                 

Gene name
Peo1
Definition
(RefSeq) progressive external ophthalmoplegia 1
  KO
K17680  twinkle protein [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    309441 (Peo1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     309441 (Peo1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    309441 (Peo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_25 DnaB_C ATPase AAA_22 AAA_16 T2SSE AAA_29 AAA_23 AAA_19 IstB_IS21 AAA_33 ABC_tran RsgA_GTPase cobW AAA_7 PhoH AAA AAA_24
Motif
Other DBs
NCBI-GeneID: 309441
NCBI-ProteinID: NP_001101069
RGD: 1307884
Ensembl: ENSRNOG00000014935
UniProt: D3ZA68
Position
1q54
AA seq 683 aa AA seqDB search
MWLLLRRAYPLRILLPLRGEWMGRRGLPRSLAPGPPRRRYRKEALPALEVPVSPVTTTEI
RQYLRAHGIPFQDGHSCLRAPSPFVAPSDIKNQKKDATTSFCLFIDKTTGHFLCMTSLAE
GSWEDLQASVEGRGDGAKEGILLGEGPEAEDREEVLRIWNRAIPLWELPDPQETQLARVM
FGLTKVTDDTLRRFNVRYLRSTRSLVFPWFTPGSSGLRGLKLLGVEGQENGVQYVETTIP
RPGVYHNLFGLPLIGRRDTEVVLTSRELDSLALSQSTGLPTLSLPRGTVCLPPALLPYLE
QFRRIVFWLGDDLRSWEAAKLFARKLNPKRCSLVRPGNQQPRPLEALNQGLSLPRILRTA
LPAWHKSIVSFRQLREEVLGELSNVDQAAGVRWSRFPDLNRLLKGHRKGELTVFTGPTGS
GKTTFISEYALDLCTQGVNTLWGSFEISNVRLARVMLTQFAVTRLEEQLDKYEEWADRFE
DLPLYFMTFHGQQSIRSVIDTMQHAVYVYDVCHVVIDNLQFMMGHEQLSTDRIAAQDYIV
GAFRKFATDNSCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLILQDRKLVTGPG
KRYLQVSKNRFDGDVGVFPLEFNKSSLTFSIPPKSKARLKKIKDDNGLVAKKSSSGKKGS
AHQNSETCIGQDPCQPDTSPSSR
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccttctccggcgtgcttatcccctccggatcttgctgccactgcgtggggag
tggatgggtaggagaggcctgccccgaagcttggctccaggccctccccgaagaaggtac
agaaaagaagcgcttccagccttagaggtaccagtatcacctgtgactacaactgaaatc
cgccaatatttacgagcacatgggatccccttccaggatggccacagctgccttcgagca
ccaagtccctttgtggcaccctcagacatcaaaaatcagaagaaggatgctaccacttcc
ttctgcctcttcatcgacaagaccacaggacactttctctgcatgaccagcctagcagaa
gggagctgggaagacctccaggccagtgtggagggacgaggcgatggggccaaagaggga
atcctacttggggagggcccagaagctgaggacagggaggaggtcttgagaatctggaac
cgagccatacctctttgggagctgcctgatccccaggaaacccagctagctcgtgtgatg
tttggccttaccaaggtgacagatgacacactcaggagattcaatgtccgctatcttcga
tctactcgaagtctggtcttcccttggttcacccctgggagctcaggattacgtggcctg
aagctactaggggttgagggtcaggaaaatggagtacagtatgtagagaccaccattccc
cggcctggtgtctatcacaacctatttggattacccctgatcggccgtagagacactgag
gtggtcctgacaagtcgagagctggacagcctggccttgagccagtccacggggctgcca
accctttccctaccccgaggaacggtctgcttacccccagccctactcccttacctcgaa
cagttccggaggattgtgttctggctaggggatgaccttcgatcgtgggaagctgccaaa
ctgtttgcccgaaaactgaaccccaagcgatgctctttggtgaggcctgggaaccaacaa
cctcgtcccctggaggccttaaaccaaggcttaagtcttccccgtattctccgtactgcc
ctccctgcctggcacaagtctattgtgtcttttcgccagctccgagaagaggttttagga
gagctatcaaatgtggaccaagcagccggtgtccgttggagccgattcccagaccttaat
cggctgctgaagggtcatcggaagggcgagctgacggtctttacagggccaacaggcagt
ggcaagacaacattcatcagtgagtatgccctggacttgtgtacccagggagtgaacaca
ctgtggggtagctttgagatcagcaatgtgagactagcccgggtcatgctgactcagttt
gctgtgacacggctagaagaacaactggacaagtatgaagagtgggcagaccgttttgag
gacctgcctctctatttcatgactttccacggacaacagagcatcaggtctgtcatagac
acaatgcaacatgctgtctacgtctatgacgtttgtcatgtagtcatcgacaacttgcag
ttcatgatgggtcatgagcagctctctactgacaggatcgcagctcaagactacattgtt
ggagcctttcggaagtttgccacagacaatagctgccacgtgactctggttattcaccca
cggaaagaagatgacgacaaggaactacagacagcatccatttttggctcagccaaagcc
agccaagaagcagacaatgttctgatcttgcaggacaggaagctggtgactgggcctggg
aaacggtatctgcaggtgtccaaaaatcgctttgatggagacgtaggcgtcttcccactt
gagttcaacaagagttcccttaccttctccatcccacctaagagcaaagcccgactcaag
aagattaaggatgacaatggactagtggccaagaagtcctcctctggaaaaaaagggtct
gcgcaccagaactctgagacttgcataggccaggacccctgccagccagatacctccccg
tcctcaaggtga

DBGET integrated database retrieval system