KEGG   Rattus norvegicus (rat): 309449Help
Entry
309449            CDS       T01003                                 

Gene name
Elovl3
Definition
(RefSeq) ELOVL fatty acid elongase 3
  KO
K10248  elongation of very long chain fatty acids protein 3 [EC:2.3.1.199]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00062  Fatty acid elongation
rno01040  Biosynthesis of unsaturated fatty acids
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
Module
rno_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    309449 (Elovl3)
   01040 Biosynthesis of unsaturated fatty acids
    309449 (Elovl3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    309449 (Elovl3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     309449 (Elovl3)
Lipid biosynthesis proteins [BR:rno01004]
 Elongase
  Unclassified
   309449 (Elovl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO DUF3464
Motif
Other DBs
NCBI-GeneID: 309449
NCBI-ProteinID: NP_001101072
RGD: 1307263
Ensembl: ENSRNOG00000019124
UniProt: D3ZPX9
Position
1q54
AA seq 271 aa AA seqDB search
MDTSMNFSRGLKTELIQPYDFEMSQDLRPFLEEYWVSSFFIVLVYLLLIIFGQNYMKTRK
GFSLQRPLILWSFCLAIFSILGTLRMWKFMGTVLFTMGLKQTVCFTDYTNDAIVKFWSWV
FLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNLGVHS
VMYTYYTMKAAKVKHPNILPMVITSLQILQMVLGTIFGILNYIWRQERGCYTTSEHFFWS
FVLYGTYFILFAQFFHRAYLRPKRKAESKSQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggacacatccatgaatttctcacgtgggttaaaaacggagctgatccaaccctatgac
ttcgagatgtcgcaggacttaaggccctttttggaggagtactgggtaagctcgtttttc
atagttcttgtctatctgttgctcatcattttcggtcaaaactacatgaaaacgcggaag
ggcttcagcttgcagaggcctctcatcctctggtccttctgcctggcaatattcagtatc
ctgggtacactgaggatgtggaagtttatgggaaccgtgctgtttacaatgggcctcaag
caaactgtgtgctttaccgactacactaatgatgccatagtgaaattctggtcctgggtc
tttcttctcagcaaggtggttgaactcggagacacggccttcatcatcctacgtaagcgt
ccactcatctttgttcactggtaccaccacagcacagtgctactgtttacgagctttgga
tacaagaacaaagtgccttccggtggctggttcatgaccatgaacttgggcgtacattcc
gtcatgtacacctactacactatgaaggcggccaaagtgaagcatcccaacatccttccc
atggtcatcactagcctgcagatcctgcagatggttttgggcaccatctttggcatactg
aattacatctggaggcaggagagaggatgctacacgacatcggaacacttcttctggtcc
ttcgtgctttatgggacctatttcatcctattcgctcaattcttccaccgagcctacctc
aggcccaagcgcaaagctgagtccaagagccaatga

DBGET integrated database retrieval system