KEGG   Rattus norvegicus (rat): 309458Help
Entry
309458            CDS       T01003                                 

Gene name
Pdcd11
Definition
(RefSeq) programmed cell death 11
  KO
K14792  rRNA biogenesis protein RRP5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    309458 (Pdcd11)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    309458 (Pdcd11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S1 Suf TPR_14 TPR_19 TPR_15 TPR_6 DUF1344 DUF2110 TPR_7
Motif
Other DBs
NCBI-GeneID: 309458
NCBI-ProteinID: NP_001101074
RGD: 1304933
Ensembl: ENSRNOG00000020304
UniProt: D3ZNI3
Position
1q54
AA seq 1876 aa AA seqDB search
MANLEESFPRGGTRKPHKSEKSSQPVVEQDNLFDISTEEGSVKRKKSQKGPAKTKKLKIE
KRKSNKSMKEKFEILSLESLCEGMRILGCVKEVNELELVVSLPNGLQGFVQVTEICDAYT
QKLNEQVAQEEPLEDLLRLPELFSPGMLVRCVVSSLDVTESGKKSVKLSVNPKRVNKVLS
AEALRPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLSLQKAQEYIRQKNKGAKFKVGQYLT
CVVEELKSNGGVVSLSVEHSQVSSAFATEEQSWNLNNLLPGLVVRAQVQKVTQFGLQLNF
LTFFTGLVDFMHLEPKKMGSYSSKQTVKACILCVHPRTRVVRLSLRPIFLHPGRPLTRIS
YQQLGTVLDDASVEGFFEKAGAIFRLRDGVLAYARLSHLSDSKKAFSAEAFKLGSTHRCR
IIDYSQMDELALLSLRKSIIAAPFLRYQDIKTGTIVKGKVLALKPFGMLVKVGEQMRGLV
PSMHLADIMMKNPEKKFNTGDEVKCRVLLCDPEAKKLIMTLKKTLVTSKLPAITCYEDAK
PGLQTHGVIIRVKDYGCLVKFYNDVQGLVPKHELSAQHIPDPERVFYTGQVVKVAVLNCE
PSKERMLLSFKLLSGSEPKDESVKNSKKKGSTVNTGQLVDVKVLEKTKNGLEVAILPHNI
PAFLPTPHLSDHVANGPLLHHWLQTGDTLHRVLCLSQSEKHILLCRKPALVSTVEGGQDP
KSLSEIQPGMLLIGFVKSIKDYGVFVQFPSGLSGLSPKTIMSDKFVTTPSEHFVEGQTVV
AKVTNVDESKQRMLLSLRLSDCSLGDSASTSFLLLCQCLEELQGIRSLMSNQDSVLIQTL
ADMTPGMVLDAMVQEVLENGSVVFGGGPVPDLILRASRYHRAGQELEPGQKKKVVVLHVD
ALKLEVHVSLHQDLVNRKARKLRKNSRHQGIVQHLEESFAVASLVETGHLVAFSLISHLN
DTFHFDSEKLRVGQGVCLTLKTTEPGVTGLILAVEGPASKRIRMPAQRDSETVDDKGEEE
EEEEEEDLTVRSKKSHSLAIGDKVTGTIKSVKATHAVVTLDDGFIGCIHVSRILDDVPEG
VSPTTTLKAGKKVTARVIGGRDVKTSKFLPISHPRFVLTILELSVRPSELKGDYRALNTH
SVSPMEKIRQYQAGQTVTCFLKKYNVMKKWLEVDIEPDIRGRIPLLLTSLSFKVLKHPDK
KFQIGQAIKATVVGPDIPRAFLCLSLIGPYKLEEGDVAMGRVLKVLPNKGLTVSFPFGRI
GKVSVFHLSDSYSEEPLTDFCPQKIVRCYILSTAHRMLALSLRSSRTNKETKSKIEDPEV
NSIEDIQAGQLLRGYVKSILPSSVVIGLGPSVMGLVKHSHVSQCVSREKELYDKCLPEGK
LVTARVLCVNPKKNLIELSLLPSDTGKPDVFSASPEPPLPKQEGREGGTEKGLKGESKRS
QRRREKNQKMREESGLYSQEKKEPRKSQRGGQSKRERQESESEQELVNKRPKKSGAPEDD
DSGVEVYYREGEDEVEEPKVPPGGKQSKPTEVPRLQLSKGFIWDVGLDSLTPALPLRGES
SDSEEDEQPHQAKKKKGKKERELEKQKAEKELSRIEEALMDPGRQPESADDFDRLVLSSP
NSSILWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVWVALLNLENMYGSQES
LAKVFERAVQYNEPLKVFLHLADIYTKSEKFKEAGELYNRMLKRFRQEKAVWIKYGAFVL
GRSQAGASHRVLQRALECLPTKEHVDVIVKFAQLEFQLGDVERAKAIFENTLTTYPKRTD
VWSVYIDMTIKHGSQKEVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKA
KALEYVEAKSSALEDQ
NT seq 5631 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacctggaggaaagcttcccccgagggggtacacggaaaccccacaaatcagag
aaatcgtcccagccggtggttgaacaagacaacttatttgacatttccacagaagaaggt
tccgttaaaaggaaaaagagccagaaagggccagcaaaaacaaaaaagttgaaaattgag
aagagaaaatccaataagtctatgaaagagaagtttgaaattcttagtcttgagtcctta
tgtgaggggatgcgaattttggggtgtgtgaaagaggtgaatgagctggagctcgtggtc
agtcttcccaatggcctccaagggtttgtgcaagtgaccgaaatctgtgatgcctacacg
cagaagctgaacgagcaggtggcacaagaggagcctctggaggacctactccgcttgcct
gagctcttctcacctggaatgctagtgaggtgtgtggtgagcagcctggatgtcacagag
agtggcaagaagagcgttaagctttccgtgaaccccaaacgtgtcaacaaagtgctgagt
gccgaggccctgaggcctggcatgctgctgacaggtacagtgtccagcctggaagaccat
ggctacctagtggacattggggttgatgggaccagagcttttctgtcactacaaaaggca
caagaatacattcgacagaagaacaaaggtgctaagttcaaagtcggccaatacctgacc
tgtgtggttgaagagctgaaaagcaacggaggagttgtgagtctctctgtagaacactcc
caggtttcttctgcctttgcaaccgaggagcagagctggaacctgaataacttactgcca
gggctggtggtcagggcccaggtgcagaaggtgactcagtttggactccagctaaatttc
cttacgttcttcacgggtctggttgacttcatgcacttggagcccaagaaaatggggtct
tattcttcaaagcaaacagtaaaggcctgcatcctctgtgtccatcctcgtaccagagtt
gtgcgactgagcctgcggcccatcttcctgcatcctggacgtccactcacccgcatctct
taccagcagctagggactgtgctggacgatgcttctgttgagggttttttcgagaaggct
ggggccatcttcaggctgagggatggggtactggcctatgcccggctcagccatctctct
gattctaagaaggcattcagtgctgaggccttcaaactggggagcactcacagatgcaga
atcattgactacagccaaatggatgagctggccctgctgtctctgcggaaatcaattatt
gcagctccgtttcttagatatcaggacatcaagacagggacaatagtaaagggcaaggtg
ctggctttgaagccatttgggatgctggtgaaggtgggtgagcaaatgagaggcctggta
ccctccatgcacctggctgacatcatgatgaagaacccagagaagaagttcaacacaggg
gacgaggtcaagtgcagggttttgctctgtgatcctgaagccaagaagctaataatgacc
ctgaagaaaacccttgtcacatccaaactacctgccattacctgctatgaggatgccaag
cctggcctacagacacatggtgttatcataagggtcaaggactatggctgccttgtgaag
ttctacaatgatgtgcaggggctagtgcccaagcacgagctcagtgcccagcacatccct
gacccagagagggtcttttacactggccaggtggtcaaggtggcagtgctgaactgtgag
ccttccaaagagaggatgctcctgtcctttaaactgttgagtggttcggagccaaaggac
gagagtgttaagaacagtaagaagaaaggaagcaccgtgaacactgggcagttggtggat
gtgaaggttctggagaagaccaaaaatgggctggaggtggccatcctgccccacaacatc
cctgcattcctcccgacgcctcacttgtctgaccatgttgccaatggcccgttgttgcat
cactggctccagacaggtgacacccttcaccgagttctgtgtctgagccagagcgagaaa
cacattcttctctgcaggaagccagctttggtctccacagtagaaggtggccaggacccc
aagagcctctcggaaatccagcccggaatgctgctcattggttttgtgaagagcattaag
gactatggagtgttcgtccagttcccctcaggtcttagtggactgtcccccaaaactatc
atgagtgacaagttcgtaaccacgccaagtgaacactttgtggagggtcagacagtcgtt
gctaaggtgaccaatgtggatgagtcgaagcaaaggatgttgctgtctctgcggctgtca
gactgcagtctgggggactcggccagcaccagcttcctcctcctgtgccagtgcctggaa
gagctgcagggcattcgaagccttatgagcaaccaagactcggtattgatccagacactg
gctgacatgaccccagggatggtccttgatgccatggtacaagaggtgttggaaaatggt
tcagtggtgttcggcgggggccctgtgcctgacctgatcctgagagccagcagataccac
cgggcagggcaggagctggagcctgggcagaagaagaaagtcgtggttctgcatgtggac
gcgttgaagttggaggtccatgtttcccttcaccaggacttggtgaataggaaagctaga
aagctgagaaaaaacagcagacaccagggaattgtacagcatctggaagagtccttcgct
gtggcctccttggtagagactggccaccttgtggctttctctctgatctctcacctcaac
gataccttccactttgactctgagaagctacgtgtggggcagggtgtctgcctcaccctc
aagaccacagaaccaggagtgactggtctgattttggctgtggaaggaccagcttctaag
agaatcaggatgccagctcagagggattcagagacagttgatgacaaaggggaggaagag
gaggaggaagaggaggaggacttgactgtgaggtctaagaagagtcatagcctggctatt
ggggacaaagtcaccgggaccattaagtctgtgaaagccacacatgctgttgtgacccta
gatgatggcttcattggttgtatccatgtatcccgcattctagatgatgtcccagagggc
gtctctcctacgaccacactgaaagctgggaagaaagtcactgcgagagtgatcggtggg
cgagatgtgaagacatctaagtttcttccaataagtcaccccagatttgttctgaccatc
ctggagctgagtgttcggccaagtgagttgaagggtgactacagggctcttaatactcac
tctgtgagccccatggagaagattaggcagtaccaggctggccagactgtgacttgcttc
ttaaagaagtacaatgtgatgaagaagtggcttgaagtggacattgaaccagacatccga
gggagaattcccttgttgctcacttcgctcagcttcaaggttctgaaacacccagacaag
aagttccagattgggcaggccatcaaggccactgttgtcggcccagacattcccagggct
ttcttatgtctgtcactcataggtccttacaaacttgaggaaggtgacgtggccatgggc
cgagtgctaaaggtgttgcccaacaagggactgactgtctccttcccctttgggaggata
gggaaagtcagtgtgtttcatttgagtgactcctactccgaggagcccctgacagacttc
tgcccccagaagattgtccgatgttatatcctgtcaacagcacaccgtatgctggccctg
tcactgcgatcatccaggacaaacaaagagacaaaaagtaaaatagaagacccagaagtg
aactccatcgaggacatccaggcagggcagctccttcggggctatgtgaagtccatcctg
ccgagtagtgtggtcataggccttggaccttcagttatgggtctggtcaagcactcacat
gtctctcagtgtgtctcacgtgagaaagagctttacgacaaatgcctccccgagggaaag
ctggtcactgccagggtcctatgtgtgaaccccaagaagaacctgatagagctgtcgctc
cttcccagcgacactgggaagccggatgtgttctctgcttccccagaaccacctcttcct
aaacaagaggggagagaaggtgggactgagaagggcctgaaaggagaatcgaagaggagt
cagagaaggagagagaagaaccagaagatgcgagaagagtctgggctgtacagccaggag
aagaaagaaccccggaagtcacagaggggtgggcagagcaagcgggagcgccaggagtct
gagagcgagcaggaactagtgaacaagaggccaaagaagtctggggcaccagaagatgac
gacagtggtgtggaagtgtactaccgggaaggagaggatgaggtggaggagccaaaggtg
cctcccgggggaaaacagagcaaacccacagaggtgccccggctgcagctctctaaaggc
ttcatctgggacgtggggctcgactctctgactccagccctgccactccgaggagagagc
tcagacagcgaggaggatgagcagccacaccaagccaagaagaagaagggcaagaaggaa
agggagctggagaagcagaaggcagagaaggagctgtcacgcattgaggaggcactcatg
gaccccgggcgacagccagaatccgcggacgactttgacaggctggtgctgagctccccc
aacagctccatcctttggctgcagtacatggctttccacctccaggccaccgagattgag
aaggcccgggctgtagctgagagggccctgaagaccatctcgttcagagaggagcaggaa
aagctgaacgtgtgggtggctctgctgaacctagaaaacatgtacggctctcaggagtcg
ctggccaaggtcttcgagcgagctgtgcagtacaatgagcctctcaaggtcttcctgcac
ctggctgacatctacaccaagtccgagaagttcaaggaagctggtgagctgtacaaccgg
atgctgaaacgattccggcaggagaaggctgtctggatcaaatatggtgcctttgttttg
gggaggagtcaggccggggccagtcaccgcgtgctgcagcgagccctggagtgcctgccc
accaaggaacatgtggatgtgattgtcaagtttgcccagctagagttccagctcggggat
gtggagcgggctaaagccatttttgaaaacacactgaccacctacccaaaacgcacagat
gtctggtcagtctacatcgacatgaccatcaagcacggcagccagaaagaagtcagggac
atctttgagcgggtcattcatctgagcctggcccccaagaggatgaagttcttcttcaag
cgctacctggactacgagaagcagcatggcaccgaaaaggacgtgcaggctgtcaaggcg
aaggccttggagtatgtggaggccaagagctcggcgctggaggaccagtag

DBGET integrated database retrieval system