KEGG   Rattus norvegicus (rat): 309574Help
Entry
309574            CDS       T01003                                 

Gene name
Olr1687
Definition
(RefSeq) olfactory receptor 1687
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    309574 (Olr1687)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    309574 (Olr1687)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    309574 (Olr1687)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 309574
NCBI-ProteinID: NP_001000508
RGD: 735190
Ensembl: ENSRNOG00000046708
UniProt: M0RDG4
Position
20p12
AA seq 321 aa AA seqDB search
MTVNCSLWQENSVSVKRFAFAKFSEVPGECFLLFTLILLMFLVSLTGNALIALTICTSPS
LHTPMYFFLANLSLLEIGYTFSVIPKMLQSLVSEARGISREGCATQMFFFTLFGISECCL
LAAMAFDRCIAICSPLHYATRMSRGVCAHLAIVSWGTGCIVGLGQTNFIFSLNFCGPCEI
DHFFCDLPPLLALACGDTSQNEAAIFVVAILCISSPFLLIIYSYVRILVAVLVMPSPEGR
HKAFSTCSSHLLVVTLFYGSGSINYLRPKSSHSPGIDKLLALFYTAVTSMLNPIIYSLRN
KEVKAALRKTLGLKKVLIMNR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcaactgttctctgtggcaggagaacagcgtgtctgtcaaacgctttgcattt
gccaagttctctgaggtccctggagaatgcttcctcctgttcaccctcatcctgctcatg
ttcttagtatcactaacaggaaatgctctcatagcccttaccatctgtaccagtccatct
ctacacacccccatgtacttctttctagccaacttgtctctcctggagattggctatact
ttttctgtcatacccaagatgctgcagagccttgtgagtgaggcccgagggatctctcgg
gagggatgtgccacacagatgtttttcttcacactttttggtataagtgagtgctgccta
ttggcggccatggcctttgaccgctgtatagccatatgctccccactccactatgcaacc
cgaatgagtcgtggggtatgtgcccatttggcaattgtttcatggggaacaggttgcatt
gtggggttgggacaaaccaattttattttctccttaaacttttgtgggccctgtgagata
gaccacttcttctgtgaccttccacctctcctggcacttgcctgtggagatacatcccaa
aacgaggctgccatctttgtggtagcaatcctctgtatatctagtccgtttttactgatc
atttattcttatgtcagaattctggtcgcagtgctcgtgatgccttcacctgaggggcgc
cataaagctttttccacctgttcgtcccacctacttgtagtcacactcttctatggctca
ggatccattaactacttgaggcccaaatctagccattcaccaggaattgataaactcttg
gctctcttctacacagcagtgacatccatgctgaaccctatcatctatagcctaaggaac
aaggaagtcaaggcagcactgagaaaaactctgggtctgaagaaagttctgataatgaat
aggtaa

DBGET integrated database retrieval system